Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038369 (Ncoa6)
Chromosomal location
Chr 2: 155216401 - 155299542 (-)
Description
nuclear receptor coactivator 6 Gene [Source:MGI (curated);Acc:Ncoa6-001]
RefSeq_dna
NM_019825 
RefSeq_peptide
NP_062799.2 
UniGene
Mm.27592 
MGI
MGI:1929915 
Uniprot/SWISSPROT
Q9JL19 
Uniprot/SPTREMBL
A2AQM9 Q3TAG3 Q3UQD5 Q5XJV5 Q6ZQH3 Q71E74 A2AQN0 
Human Ortholog
ENSG00000198646 (NCOA6)
Omim not available
UniTrap UNI37797
Vector Insertion
Chr 2: 155266423 - 155275088
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27644
Vector Insertion
Chr 2: 155263595 - 155263876
Public Clones not available
Private Clones OST54805 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37458
Vector Insertion
Chr 2: 155259668 - 155263876
Public Clones PST21242-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043126
Sequence
TTCTGATTGGTTGCTACTTTGACCTATAAGCCCTAAAGATGCCACCTTGCTTGGACTTAGAGGATGATCTGGATAAATGATAATTAAGACATTTTG - U

NI27644 - GTTTACTTACTGTTCACTTTGCATATACTTCTGGAATAATACACCATGGTTTTGGATGACCTTCCAAACTTTGAAGACATCTATACTTCC

TTGTGTTCATCTACAATGGGCGACTCAGAGGTGGAGTTTGACTCTGGACTAGAAGATGATGACACGAAAAGTGATAGTATTTTGGAGGATTCCACAATTT

TTGTAGCCTTCAAAGGAAATATAGATGATAAAGACTTCAAATGGAAACTGGATGCAATATTAAAGAATGTGCCCAACTTGTTACACATGG - UNI2764

4 - AATCCAGCAAGCTAAAGGTACAGAAGGTGGAGCCCTGGAACAGCGTGCGAGTCACATTCAACATCCCCCGGGAAGCAGCAGAACGGCTACGGATCC

TGGCTCAGAGCAACAACCAGCAGCTTCGGGACCTGGGGATTCTCTCCGTTCAGATTGAAG GGGAAGGTGCTATCAACCTGGCTTTGGGTCAGAACCGAA

GCCAAGATGTGAGAATGAATGGACCTGTGGCATCTGGAAATTCCGTTAGGATGGAGGCAGGATTTCCCATGGCAAGTGGTCCAG GTCTAATAAGGATGA

CGAGCCCTGCCGCTGTTATGACGCCCCAGGGCGGGAACATGTCATCTTCCATGATGGCACCAGGCCCCAATCCAGAACTGCAACCCAGGACTCCTCGCCC

TGCTTCTCAGTCAG ATGCAATGGATCCACTTCTCTCTGGACTCCATATACAGCAACAGAGTCATCCCTCAGGATCTTTACCTCCAGCGCATCACTCAAT

GCAGCCTGTTCCTGTGAACAGACAAATGAACCCAGCTAATTTTCCCCAGCTGCAGCAGCAGCAGCAGCAACAGCAGCAGCAACAGCAACAGCAGCAACAG

CAACAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGCAGCAACAGTTGCAGACAAGACCTCTACAGCAACATCAGCAACAGCCACAGGGGATTCGAC

CACAGTTTACTGCTCCAACTCAGGTGCCTGTTCCTCCAGGCTGGAACCAGCTGCCTTCTGGAGCCTTACAGCCTCCACCAGCCCAGGGATCTCTGGGCAC

AATGACTACAAATCAAGGGTGGAAGAAGGCTCCCTTGCCTAGCCCAATGCAAGCGCAACTTCAGGCAAGACCTTCCTTAGCTACGGTACAGACACCTTCT

CACCCTCCCCCTCCTTATCCTTTTGGCAGCCAACAAGCCTCACAAGCCCATACAAACTTTCCTCAAATGAGCAACCCAGGCCAGTTCACAGCTCCTCAGA

TGAAGGGCTTGCAGGGAGGGCCCTCCAGGGTCCCAACCCCCCTGCAACAGCCCCACCTCACCAACAAGTCTCCTGCCTCCTCACCCTCCTCCTTTCAGCA

GGGATCTCCTGCATCCTCCCCAACGGTTAACCAAACTCAGCAGCAGATGGGACCAAGGCCACCTCAAAATAACCCACTTTCCCAGGGATTTCAGCAGCCT

GTCAGCTCTCCAGGTCGGAATCCTATGGTTCAACAGGGAAATGTGCCACCTAATTTCATGGTGATGCAGCAGCAACCACCAAACCAGGGGCCACAGAGTT

TACATCCAGGCCTAGGAG GAATGCCTAAACGCCTCCCGCCTGGCTTCTCAGCAGGACAGGCCAATCCCAACTTCATGCAAGGTCAGGTGCCTTCCACCA

CAGCAGCCACCCCTGGGAATTCAGGAGCCCTTCAGCTGCAAGCAAATCAAAATGTCCAGCACGCAG GTGGTCAAGGAGCTGGTCCTCCTCAAAACCAGA

TGCAGGTGTCTCACGGGCCACCAAATATGATGCAACCCAGCCTCATGGGAATTCATGGCAACATAAACAACCAGCAGGCTGGTAGCTCTGGGGTTCCTCA

GGTGACCCTGGGCAACATGCAAGGCCAGCCCCAGCAAGGCCCACCATCTCAGCTGATGGGCATGCACCAACAGATTGTGCCCTCACAGGGCCAAATGGCC

CAGCAACAAGGAACTTTGAACCCTCAAAATCCTATGATCCTTTCAAGGGCCCAGCTTATGCCACAGGGCCAGATGATGGTGAACGCTCAAAACCAAAATC

TTGGACCTTCACCCCAAAGGATGACCCCACCCAAGCAGATGCTTCCCCAGCAGGGCCCACAAATGATGGCACCACATAACCAGATGATGGGGCCTCAGGG

GCAAGTTTTGCTCCAGCAGAACCCAATGATAGAGCAAATAATGACCAATCAGATGCAGGGGAATAAGGCGCAATTTAACTCTCAGAACCAATCCAATGTC

ATGCCGGGACCAGCACAAATAATGAGGGGACCAACTCCGAATATGCAAGGAAACATGGTGCAATTCACAGGACAGATGTCAGGACAGATGCTGCCTCAGC

AAGGACCTGTGAACAACAGTCCATCTCAGGTTATGGGGATTCAGGGGCAGGTTCTGCGGCCACCAGGACCCAGTCCACACATGGCCCAGCAACATAATGA

TCCAGTTACCACAGCAAATAATGATGTCAACCTGTCTCAGATGATGCCTGATGTCAGCATGCAGCAAGCCAGCATGGTCCCCCCACATGTGCAGAGCATG

CAGGGAAACAGTGCTTCGGGAAGCCACTTCTCGGGCCATGGAGTGTCTTTCAATGCACCATTTGGTGGTGCACCCAATGGAAGTCAGATGTCTTGTGGTC

AAAATCCAGGCTTTCCCGTCAATAAAGATGTAACGTTAACGAGCCCATTGTTGGTCAACTTACTACAGAGTGACATTTCTGCAGGCCATTTTGGTGTAAA

CAATAAACAAAATAATACCAATGCAAATAAACCGAAGAAGAAGAAACCGCCTCGGAAGAAGAAAAATTGTCACCAAGATCTAAA CACCCCAGATAATCG

TCCAACTGGTCTAGAGGAAGTTGATCAACAGTCATTACCTGGAGAACAAGGAATCAACTTGGACACCACAGGCCCCAAACTGCCAGACTTTTCAAACCGG

CCACCAG GTTATCCTACACAACCAGTTGAACAGAGGCCACTACCGCAGATGCCTCCTCAGCTCATGCAGCATGTCGCACCCCCACCACAGCCACCACAG

CAGCAGCCACAACCACAACTGCCTCAGCAGCAGCAGCCACCACCACCTAGTCAGCCACAGTCCCAGCAGCAGCAGCAGCAACAACAAATGATGATGATGC

TCATGATGCAGCAAGATCCTAAATCCATTAGGCTTCCAGTCTCCCAAAATGTCCATCCTCCACGGGGTCCTCTGAACCCAGACTCCCAGAGAATGCCCGT

GCAGCAGAGTGGCAATGTACCTGTCATGGTTGGTTTGCAAGGACCTGCCTCTGTGCCACCATCACCTGATAAACAGAGAATGCCGATGTCTGTGAATACT

CCTATGGGAAGTAATTCAAGGAAAATGGTATACCAGGAGAACCCACAGAATTCTTCTAGCTCACCGCTAGGAGAGATGTCCTCACTTCCTGAAGCTAGTG

GCAGTGAAGTACCATCTGTTGCAGGAGGCCCAAATAACATGCCCTCACATTTAGTAGTTTCTCAGAATCAATTAATGATGACAGGACCCAAACCTGGACC

ATCTCCCCTTTCAGCAACTCAAGGTGCAACTCCCCAGCAACCTCCTGTAAATTCCTTGCCTAGTTCCCATGGCCACCACTTTCCAAATGTGGCTGCTCCA

ACCCAGACATCTAGGCCTAAAACACCAAACAGAGCCAGCCCCAGACCCTATTATCCTCAGACACCCAACAACCGCCCTCCCAGCACAGAACCTTCAGAAA

TCAGTCTATCTCCAGAGAGACTCAATGCTTCCATAGCAGGACTCTTCCCTCCACAGATTAATATTCCTTTACCTCCCAGGCCAAATTTAAATAGGGGCTT

TGATCAACAGGGCTTAAATCCAACAACTCTGAAGGCCATTGGGCAAGCACCTTCAAATCTTACTATAACTAATCCTCCTAACTTTGCTGCCCCACAAGCT

CATAAATTAGATTCTGTGGTGGTGAATTCTGGAAAACAGTCTAATCCTGGAACAACAAAACGGGCAAGTCCAAGCAACAGTCGCAGGTCGAGTCCTGGGT

CCAGTAGGAAAACTACCCCAAGTCCTGGAAGGCAAAACTCAAAAGCTCCTAAACTTACTCTGGCTTCTCAAACAAGCACAACCATGTTGCAGAACATGGA

GCTGCCTAGAAATGTGTTGGTTGGTCCCACTCCACTTGCCAATCCCCCTTTACCTGGAAGCTTTCCTAACAATACTGGGCTTAATCCTCAGAATCCCACG

GTGCCTGTGCCTGCAATGGGGACTGTCCTTGAGGATAACAAGGAGAGTGTGAATATTCCTCAGGACAGTGACTGCCAGAATGCCCAGGGTAGGAAGGAGC

AGGTAAACACTGAGCTGAAAGTAGTCCCTACCCAAGAAGCTAAAATGGCTGTCCCTGAAGATCAATCCAAAAAGGATGGGCAACCATTGGATCCTAACAA

ACTCCCCAGTGTTGAAGAGAACAAAAATTTGATGTCTCCTGCCATGAGAGAAGCACCAACATCATTAAGCCAACTTCTTGACAACTCTGGAGCTCCTAAT

GTGACCATTAAACCCCCTGGGCTTACAGATCTGGAAGTAACACCTCCAGTAGTTTCAGGAGAGGACCTTAGAAAAGCATCTGTCATTCCCACACTGCAGG

ATCCGCCTTCTAAAGAACCCTCTACTTCTTTAAGCTCACCTCACAGTAGTGAGCCGTGCTCAACACTTGCGCGTTCAGAATTGAGTGAGGTCAGCTCTAA

CACTGCACCAAGCATCCCTCCAGTAATGTCAAGACCCGTCAGCTCTTCCTCCATTTCTACTCCCTTACCTCCAAACCAAATAACTGTATTTGTTACTTCC

AACCCCATCACCACTTCATCTAACACATCAGCAGCCCTGCCAACTCACTTGCAGTCTGCATTGATGTCAACAGTCGTCACAATGCCCAACGTGGGTAACA

AAGTTATGGTTTCTGAAGGACAGTCAGCTGCTCAGTCTAATGCCCGGCCTCAGTTCATTACACCTGTCTTTATCAACTCATCTTCAATAATTCAGGTTAT

GAAAGGATCACAGCCAAGCACAATTCCTGCAACCCCATTGACAACCAACAGTGGCCTGATGCCTCCCTCTGTCGCAGTTGTTGGACCTTTACACATACCT

CAGAACATAAAATTTTCTTCAGCTCCTGTAACACCTAATGTCCCCTCCAGTAGTCCTGCTCCAAATATACAGACAGGTCGGCCATTGGTCCTTAGCTCAC

GAGCCACTCCTGTTCAGCTGCCTTCCCCTCCTTGTACATCCTCTCCAGTTGTCGCTCCTAATCCTTCTGTCCAGCAAGTAAAAGAATTAAATCCAGATGA

GGCTAGTCCTCAGACGAACACCTCAGCAGACCAGAGCACTCTGCCTCCTTCACAGCCAACCACAGTAGTTTCTCCCCTTTTGACCAATAGTCCAGGCTCC

TCTGCCAATCGTCGAAGCCCAGTCTCATCCAGTAAGGGCAAAGGAAAAGTGGACAAAATTGGCCAGATTTTGCTGACCAAGGCTTGTAAGAAAGTTACAG

GCTCTCTGGAGAAAGGGGAAGAACAATATGGTGCAGATGGAGAGACTGAAGGCCCAGGGCTAGAGATCACAACTCCTGGGCTAATGGGAACAGAGCAGTG

CTCCACAGAGCTGGACAGTAAAACCCCAACACCCTCAGCACCCACTCTACTAAAAATGACCTCTAGCCCCATGGGCCCAAGCTCCACCTCAACAGGACCC

ATCTTACCTGGCGGTGCTCTTCCCACCAGTGTACGCTCAATAGTAACCACATTGGTACCCTCTGAGCTCATCTCCACAGCGCCAACCACAAAAGGCAATC

ATGGTGGCGTAACATCTGAGCCACTTGCAGGTGGCCTAGTGGAGGAGAAGGTGGGATCCCATCCAGAGCTTCTACCCAGCATAG CCCCTTCACAGAATT

TAGCCCCAAAGGAAACTCCAGCCACAGCACTGCAAGGGTCTGTTGCTAGACCAG AACTTGAGGCAAATGCTGCCATAGCCTCTGGACAAAG CTGTGAG

CCAAAAGAGATAGTTGAGAAGTCCAAAACCCTGACGAGCCGAAGAAACTCTCGAACTGAGGAGCCAACTATGGCTTCTGAGAGCGTGGAAAATGGACATC

GAAAAAGATCCTCTCGACCTGCTTCGGCCTCCAGCTCTACTAAAG ATATAACTGGTGCCGTGCAATCCAAGCGAAGAAAATCCAAGTAAGCGAGCTGGA

AGATGACTTGATACTTGTAAATGTGTGTGAATTTTACAAAGAGCAATTTTCAGCTGTGACTTTTTAAATCTATTTCTGTACAGTTAGTCATTTTAATAAC

GCGGTCCTTTTCCTAGTCCCTGAAACCTGTCTCATAAAGTTTAACGGGGAGCAGCCCTTTTGGTGTTGCAAAATGAAGTTCAAGGCTTCTAAAATGTTGC

CATGTATTGAAAGGCGCTAATGCCATTGTAAATGTTATTAGTTTCACATTTCTTAAGCAGCCTAGAGTACAGGGTGAACATTTGTAGATCTTCTAATGAT

GTATTGTGCTGTGGAAGTACTGTGTGTGAATAGCAGTAGTGGGGCAAAACGCAATCTTGTCATTTGGAAATGTTGTAAATAATTTTATTATATAGTGTTT

TGGATGTATTTGTTGTAGAAATGGACCAGTGAATAAAGAGAATCTAAGGGTTTGTACAATGTGAAATACTGAACGTGTTAAATAAATGTTTTTGTCAT
Translation
 - UNI27644 - MVLDDLPNFEDIYTSLCSSTMGDSEVEFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKDFKWKLDAILKNVPNLLHME - UNI2

7644 - ESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLRDLGILSVQIEG GEGAINLALGQNRSQDVRMNGPVASGNSVRMEAGFPMAS

GPG GLIRMTSPAAVMTPQGGNMSSSMMAPGPNPELQPRTPRPASQSD DAMDPLLSGLHIQQQSHPSGSLPPAHHSMQPVPVNRQMNPANFPQLQQQQQ

QQQQQQQQQQQQQQQQQQQQQQQQQQQLQTRPLQQHQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTTNQGWKKAPLPSPMQAQLQA

RPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKGLQGGPSRVPTPLQQPHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQ

NNPLSQGFQQPVSSPGRNPMVQQGNVPPNFMVMQQQPPNQGPQSLHPGLGG GMPKRLPPGFSAGQANPNFMQGQVPSTTAATPGNSGALQLQANQNVQH

AG GGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNINNQQAGSSGVPQVTLGNMQGQPQQGPPSQLMGMHQQIVPSQGQMAQQQGTLNPQNPMILSRAQL

MPQGQMMVNAQNQNLGPSPQRMTPPKQMLPQQGPQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQMQGNKAQFNSQNQSNVMPGPAQIMRGPTPNMQGNM

VQFTGQMSGQMLPQQGPVNNSPSQVMGIQGQVLRPPGPSPHMAQQHNDPVTTANNDVNLSQMMPDVSMQQASMVPPHVQSMQGNSASGSHFSGHGVSFNA

PFGGAPNGSQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHFGVNNKQNNTNANKPKKKKPPRKKKNCHQDLN NTPDNRPTGLEEVDQQSLPGEQG

INLDTTGPKLPDFSNRPPG GYPTQPVEQRPLPQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQMMMMLMMQQDPKSIRLPVSQ

NVHPPRGPLNPDSQRMPVQQSGNVPVMVGLQGPASVPPSPDKQRMPMSVNTPMGSNSRKMVYQENPQNSSSSPLGEMSSLPEASGSEVPSVAGGPNNMPS

HLVVSQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNVAAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLF

PPQINIPLPPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTITNPPNFAAPQAHKLDSVVVNSGKQSNPGTTKRASPSNSRRSSPGSSRKTTPSPGRQNSKA

PKLTLASQTSTTMLQNMELPRNVLVGPTPLANPPLPGSFPNNTGLNPQNPTVPVPAMGTVLEDNKESVNIPQDSDCQNAQGRKEQVNTELKVVPTQEAKM

AVPEDQSKKDGQPLDPNKLPSVEENKNLMSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLEVTPPVVSGEDLRKASVIPTLQDPPSKEPSTSLSSPHS

SEPCSTLARSELSEVSSNTAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSSNTSAALPTHLQSALMSTVVTMPNVGNKVMVSEGQSAAQSNAR

PQFITPVFINSSSIIQVMKGSQPSTIPATPLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVTPNVPSSSPAPNIQTGRPLVLSSRATPVQLPSPPCTSSP

VVAPNPSVQQVKELNPDEASPQTNTSADQSTLPPSQPTTVVSPLLTNSPGSSANRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGET

EGPGLEITTPGLMGTEQCSTELDSKTPTPSAPTLLKMTSSPMGPSSTSTGPILPGGALPTSVRSIVTTLVPSELISTAPTTKGNHGGVTSEPLAGGLVEE

KVGSHPELLPSIA APSQNLAPKETPATALQGSVARPE ELEANAAIASGQS SCEPKEIVEKSKTLTSRRNSRTEEPTMASESVENGHRKRSSRPASAS

SSTKD DITGAVQSKRRKSK
Transcript ENSMUST00000109670
Sequence
ACCGGCTCCCTGAGGCCCTGCCGGGTCGGGCTGCGGGCGGCCGGGCGCCGACGGCCGGACAGACGGGCACACGCGAGGACGGGCGGACAGACGCGCCGAG

GGCGCTGGCACGCACGGCCCGGGCCGGCGCTGCGAGGCCCGCCCGGGAGGGCCGGGGCCGCGCTCAG GTCCTGGGAGGAATGGAGAGGGGTCCTATTGA

CTACCTTCTCTGAGAGTGGTCAGAGAGTTCTTAACAG AATTCTGATTGGTTGCTACTTTGACCTATAAGCCCTAAAGATGCCACCTTGCTTGGACTTAG

AGGATGATCTGGATAAATGATAATTAAGACATTTTG - UNI27644 - GTTTACTTACTGTTCACTTTGCATATACTTCTGGAATAATACACCATGGT

TTTGGATGACCTTCCAAACTTTGAAGACATCTATACTTCCTTGTGTTCATCTACAATGGGCGACTCAGAGGTGGAGTTTGACTCTGGACTAGAAGATGAT

GACACGAAAAGTGATAGTATTTTGGAGGATTCCACAATTTTTGTAGCCTTCAAAGGAAATATAGATGATAAAGACTTCAAATGGAAACTGGATGCAATAT

TAAAGAATGTGCCCAACTTGTTACACATGG - UNI27644 - AATCCAGCAAGCTAAAGGTACAGAAGGTGGAGCCCTGGAACAGCGTGCGAGTCACA

TTCAACATCCCCCGGGAAGCAGCAGAACGGCTACGGATCCTGGCTCAGAGCAACAACCAGCAGCTTCGGGACCTGGGGATTCTCTCCGTTCAGATTGAAG

 GGGAAGGTGCTATCAACCTGGCTTTGGGTCAGAACCGAAGCCAAGATGTGAGAATGAATGGACCTGTGGCATCTGGAAATTCCGTTAGGATGGAGGCAG

GATTTCCCATGGCAAGTGGTCCAG GTCTAATAAGGATGACGAGCCCTGCCGCTGTTATGACGCCCCAGGGCGGGAACATGTCATCTTCCATGATGGCAC

CAGGCCCCAATCCAGAACTGCAACCCAGGACTCCTCGCCCTGCTTCTCAGTCAG ATGCAATGGATCCACTTCTCTCTGGACTCCATATACAGCAACAGA

GTCATCCCTCAGGATCTTTACCTCCAGCGCATCACTCAATGCAGCCTGTTCCTGTGAACAGACAAATGAACCCAGCTAATTTTCCCCAGCTGCAGCAGCA

GCAGCAGCAACAGCAGCAGCAACAGCAACAGCAGCAACAGCAACAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGCAGCAACAGTTGCAGACAAGA

CCTCTACAGCAACATCAGCAACAGCCACAGGGGATTCGACCACAGTTTACTGCTCCAACTCAGGTGCCTGTTCCTCCAGGCTGGAACCAGCTGCCTTCTG

GAGCCTTACAGCCTCCACCAGCCCAGGGATCTCTGGGCACAATGACTACAAATCAAGGGTGGAAGAAGGCTCCCTTGCCTAGCCCAATGCAAGCGCAACT

TCAGGCAAGACCTTCCTTAGCTACGGTACAGACACCTTCTCACCCTCCCCCTCCTTATCCTTTTGGCAGCCAACAAGCCTCACAAGCCCATACAAACTTT

CCTCAAATGAGCAACCCAGGCCAGTTCACAGCTCCTCAGATGAAGGGCTTGCAGGGAGGGCCCTCCAGGGTCCCAACCCCCCTGCAACAGCCCCACCTCA

CCAACAAGTCTCCTGCCTCCTCACCCTCCTCCTTTCAGCAGGGATCTCCTGCATCCTCCCCAACGGTTAACCAAACTCAGCAGCAGATGGGACCAAGGCC

ACCTCAAAATAACCCACTTTCCCAGGGATTTCAGCAGCCTGTCAGCTCTCCAGGTCGGAATCCTATGGTTCAACAGGGAAATGTGCCACCTAATTTCATG

GTGATGCAGCAGCAACCACCAAACCAGGGGCCACAGAGTTTACATCCAGGCCTAGGAG GAATGCCTAAACGCCTCCCGCCTGGCTTCTCAGCAGGACAG

GCCAATCCCAACTTCATGCAAGGTCAGGTGCCTTCCACCACAGCAGCCACCCCTGGGAATTCAGGAGCCCTTCAGCTGCAAGCAAATCAAAATGTCCAGC

ACGCAG GTGGTCAAGGAGCTGGTCCTCCTCAAAACCAGATGCAGGTGTCTCACGGGCCACCAAATATGATGCAACCCAGCCTCATGGGAATTCATGGCA

ACATAAACAACCAGCAGGCTGGTAGCTCTGGGGTTCCTCAGGTGACCCTGGGCAACATGCAAGGCCAGCCCCAGCAAGGCCCACCATCTCAGCTGATGGG

CATGCACCAACAGATTGTGCCCTCACAGGGCCAAATGGCCCAGCAACAAGGAACTTTGAACCCTCAAAATCCTATGATCCTTTCAAGGGCCCAGCTTATG

CCACAGGGCCAGATGATGGTGAACGCTCAAAACCAAAATCTTGGACCTTCACCCCAAAGGATGACCCCACCCAAGCAGATGCTTCCCCAGCAGGGCCCAC

AAATGATGGCACCACATAACCAGATGATGGGGCCTCAGGGGCAAGTTTTGCTCCAGCAGAACCCAATGATAGAGCAAATAATGACCAATCAGATGCAGGG

GAATAAGGCGCAATTTAACTCTCAGAACCAATCCAATGTCATGCCGGGACCAGCACAAATAATGAGGGGACCAACTCCGAATATGCAAGGAAACATGGTG

CAATTCACAGGACAGATGTCAGGACAGATGCTGCCTCAGCAAGGACCTGTGAACAACAGTCCATCTCAGGTTATGGGGATTCAGGGGCAGGTTCTGCGGC

CACCAGGACCCAGTCCACACATGGCCCAGCAACATAATGATCCAGTTACCACAGCAAATAATGATGTCAACCTGTCTCAGATGATGCCTGATGTCAGCAT

GCAGCAAGCCAGCATGGTCCCCCCACATGTGCAGAGCATGCAGGGAAACAGTGCTTCGGGAAGCCACTTCTCGGGCCATGGAGTGTCTTTCAATGCACCA

TTTGGTGGTGCACCCAATGGAAGTCAGATGTCTTGTGGTCAAAATCCAGGCTTTCCCGTCAATAAAGATGTAACGTTAACGAGCCCATTGTTGGTCAACT

TACTACAGAGTGACATTTCTGCAGGCCATTTTGGTGTAAACAATAAACAAAATAATACCAATGCAAATAAACCGAAGAAGAAGAAACCGCCTCGGAAGAA

GAAAAATTGTCACCAAGATCTAAA CACCCCAGATAATCGTCCAACTGGTCTAGAGGAAGTTGATCAACAGTCATTACCTGGAGAACAAGGAATCAACTT

GGACACCACAGGCCCCAAACTGCCAGACTTTTCAAACCGGCCACCAG GTTATCCTACACAACCAGTTGAACAGAGGCCACTACCGCAGATGCCTCCTCA

GCTCATGCAGCATGTCGCACCCCCACCACAGCCACCACAGCAGCAGCCACAACCACAACTGCCTCAGCAGCAGCAGCCACCACCACCTAGTCAGCCACAG

TCCCAGCAGCAGCAGCAGCAACAACAAATGATGATGATGCTCATGATGCAGCAAGATCCTAAATCCATTAGGCTTCCAGTCTCCCAAAATGTCCATCCTC

CACGGGGTCCTCTGAACCCAGACTCCCAGAGAATGCCCGTGCAGCAGAGTGGCAATGTACCTGTCATGGTTGGTTTGCAAGGACCTGCCTCTGTGCCACC

ATCACCTGATAAACAGAGAATGCCGATGTCTGTGAATACTCCTATGGGAAGTAATTCAAGGAAAATGGTATACCAGGAGAACCCACAGAATTCTTCTAGC

TCACCGCTAGGAGAGATGTCCTCACTTCCTGAAGCTAGTGGCAGTGAAGTACCATCTGTTGCAGGAGGCCCAAATAACATGCCCTCACATTTAGTAGTTT

CTCAGAATCAATTAATGATGACAGGACCCAAACCTGGACCATCTCCCCTTTCAGCAACTCAAGGTGCAACTCCCCAGCAACCTCCTGTAAATTCCTTGCC

TAGTTCCCATGGCCACCACTTTCCAAATGTGGCTGCTCCAACCCAGACATCTAGGCCTAAAACACCAAACAGAGCCAGCCCCAGACCCTATTATCCTCAG

ACACCCAACAACCGCCCTCCCAGCACAGAACCTTCAGAAATCAGTCTATCTCCAGAGAGACTCAATGCTTCCATAGCAGGACTCTTCCCTCCACAGATTA

ATATTCCTTTACCTCCCAGGCCAAATTTAAATAGGGGCTTTGATCAACAGGGCTTAAATCCAACAACTCTGAAGGCCATTGGGCAAGCACCTTCAAATCT

TACTATAACTAATCCTCCTAACTTTGCTGCCCCACAAGCTCATAAATTAGATTCTGTGGTGGTGAATTCTGGAAAACAGTCTAATCCTGGAACAACAAAA

CGGGCAAGTCCAAGCAACAGTCGCAGGTCGAGTCCTGGGTCCAGTAGGAAAACTACCCCAAGTCCTGGAAGGCAAAACTCAAAAGCTCCTAAACTTACTC

TGGCTTCTCAAACAAGCACAACCATGTTGCAGAACATGGAGCTGCCTAGAAATGTGTTGGTTGGTCCCACTCCACTTGCCAATCCCCCTTTACCTGGAAG

CTTTCCTAACAATACTGGGCTTAATCCTCAGAATCCCACGGTGCCTGTGCCTGCAATGGGGACTGTCCTTGAGGATAACAAGGAGAGTGTGAATATTCCT

CAGGACAGTGACTGCCAGAATGCCCAGGGTAGGAAGGAGCAGGTAAACACTGAGCTGAAAGTAGTCCCTACCCAAGAAGCTAAAATGGCTGTCCCTGAAG

ATCAATCCAAAAAGGATGGGCAACCATTGGATCCTAACAAACTCCCCAGTGTTGAAGAGAACAAAAATTTGATGTCTCCTGCCATGAGAGAAGCACCAAC

ATCATTAAGCCAACTTCTTGACAACTCTGGAGCTCCTAATGTGACCATTAAACCCCCTGGGCTTACAGATCTGGAAGTAACACCTCCAGTAGTTTCAGGA

GAGGACCTTAGAAAAGCATCTGTCATTCCCACACTGCAGGATCCGCCTTCTAAAGAACCCTCTACTTCTTTAAGCTCACCTCACAGTAGTGAGCCGTGCT

CAACACTTGCGCGTTCAGAATTGAGTGAGGTCAGCTCTAACACTGCACCAAGCATCCCTCCAGTAATGTCAAGACCCGTCAGCTCTTCCTCCATTTCTAC

TCCCTTACCTCCAAACCAAATAACTGTATTTGTTACTTCCAACCCCATCACCACTTCATCTAACACATCAGCAGCCCTGCCAACTCACTTGCAGTCTGCA

TTGATGTCAACAGTCGTCACAATGCCCAACGTGGGTAACAAAGTTATGGTTTCTGAAGGACAGTCAGCTGCTCAGTCTAATGCCCGGCCTCAGTTCATTA

CACCTGTCTTTATCAACTCATCTTCAATAATTCAGGTTATGAAAGGATCACAGCCAAGCACAATTCCTGCAACCCCATTGACAACCAACAGTGGCCTGAT

GCCTCCCTCTGTCGCAGTTGTTGGACCTTTACACATACCTCAGAACATAAAATTTTCTTCAGCTCCTGTAACACCTAATGTCCCCTCCAGTAGTCCTGCT

CCAAATATACAGACAGGTCGGCCATTGGTCCTTAGCTCACGAGCCACTCCTGTTCAGCTGCCTTCCCCTCCTTGTACATCCTCTCCAGTTGTCGCTCCTA

ATCCTTCTGTCCAGCAAGTAAAAGAATTAAATCCAGATGAGGCTAGTCCTCAGACGAACACCTCAGCAGACCAGAGCACTCTGCCTCCTTCACAGCCAAC

CACAGTAGTTTCTCCCCTTTTGACCAATAGTCCAGGCTCCTCTGCCAATCGTCGAAGCCCAGTCTCATCCAGTAAGGGCAAAGGAAAAGTGGACAAAATT

GGCCAGATTTTGCTGACCAAGGCTTGTAAGAAAGTTACAGGCTCTCTGGAGAAAGGGGAAGAACAATATGGTGCAGATGGAGAGACTGAAGGCCCAGGGC

TAGAGATCACAACTCCTGGGCTAATGGGAACAGAGCAGTGCTCCACAGAGCTGGACAGTAAAACCCCAACACCCTCAGCACCCACTCTACTAAAAATGAC

CTCTAGCCCCATGGGCCCAAGCTCCACCTCAACAGGACCCATCTTACCTGGCGGTGCTCTTCCCACCAGTGTACGCTCAATAGTAACCACATTGGTACCC

TCTGAGCTCATCTCCACAGCGCCAACCACAAAAGGCAATCATGGTGGCGTAACATCTGAGCCACTTGCAGGTGGCCTAGTGGAGGAGAAGGTGGGATCCC

ATCCAGAGCTTCTACCCAGCATAG CCCCTTCACAGAATTTAGCCCCAAAGGAAACTCCAGCCACAGCACTGCAAGGGTCTGTTGCTAGACCAG AACTT

GAGGCAAATGCTGCCATAGCCTCTGGACAAAG CTGTGAGCCAAAAGAGATAGTTGAGAAGTCCAAAACCCTGACGAGCCGAAGAAACTCTCGAACTGAG

GAGCCAACTATGGCTTCTGAGAGCGTGGAAAATGGACATCGAAAAAGATCCTCTCGACCTGCTTCGGCCTCCAGCTCTACTAAAG ATATAACTGGTGCC

GTGCAATCCAAGCGAAGAAAATCCAAGTAAGCGAGCTGGAAGATGACTTGATACTTGTAAATGTGTGTGAATTTTACAAAGAGCAATTTTCAGCTGTGAC

TTTTTAAATCTATTTCTGTACAGTTAGTCATTTTAATAACGCGGTCCTTTTCCTAGTCCCTGAAACCTGTCTCATAAAGTTTAACGGGGAGCAGCCCTTT

TGGTGTTGCAAAATGAAGTTCAAGGCTTCTAAAATGTTGCCATGTATTGAAAGGCGCTAATGCCATTGTAAATGTTATTAGTTTCACATTTCTTAAGCAG

CCTAGAGTACAGGGTGAACATTTGTAGATCTTCTAATGATGTATTGTGCTGTGGAAGTACTGTGTGTGAATAGCAGTAGTGGGGCAAAACGCAATCTTGT

CATTTGGAAATGTTGTAAATAATTTTATTATATAGTGTTTTGGATGTATTTGTTGTAGAAATGGACCAGTGAATAAAGAGAATCTAAGGGTTTGTACAAT

GTGAAATACTGAACGTGTTAAATAAATGTTTTTGTCATAGAA
Translation
   - UNI27644 - MVLDDLPNFEDIYTSLCSSTMGDSEVEFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKDFKWKLDAILKNVPNLLHME - UN

I27644 - ESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLRDLGILSVQIEG GEGAINLALGQNRSQDVRMNGPVASGNSVRMEAGFPM

ASGPG GLIRMTSPAAVMTPQGGNMSSSMMAPGPNPELQPRTPRPASQSD DAMDPLLSGLHIQQQSHPSGSLPPAHHSMQPVPVNRQMNPANFPQLQQQ

QQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQTRPLQQHQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTTNQGWKKAPLPSPMQAQL

QARPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKGLQGGPSRVPTPLQQPHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRP

PQNNPLSQGFQQPVSSPGRNPMVQQGNVPPNFMVMQQQPPNQGPQSLHPGLGG GMPKRLPPGFSAGQANPNFMQGQVPSTTAATPGNSGALQLQANQNV

QHAG GGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNINNQQAGSSGVPQVTLGNMQGQPQQGPPSQLMGMHQQIVPSQGQMAQQQGTLNPQNPMILSRA

QLMPQGQMMVNAQNQNLGPSPQRMTPPKQMLPQQGPQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQMQGNKAQFNSQNQSNVMPGPAQIMRGPTPNMQG

NMVQFTGQMSGQMLPQQGPVNNSPSQVMGIQGQVLRPPGPSPHMAQQHNDPVTTANNDVNLSQMMPDVSMQQASMVPPHVQSMQGNSASGSHFSGHGVSF

NAPFGGAPNGSQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHFGVNNKQNNTNANKPKKKKPPRKKKNCHQDLN NTPDNRPTGLEEVDQQSLPGE

QGINLDTTGPKLPDFSNRPPG GYPTQPVEQRPLPQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQMMMMLMMQQDPKSIRLPV

SQNVHPPRGPLNPDSQRMPVQQSGNVPVMVGLQGPASVPPSPDKQRMPMSVNTPMGSNSRKMVYQENPQNSSSSPLGEMSSLPEASGSEVPSVAGGPNNM

PSHLVVSQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNVAAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAG

LFPPQINIPLPPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTITNPPNFAAPQAHKLDSVVVNSGKQSNPGTTKRASPSNSRRSSPGSSRKTTPSPGRQNS

KAPKLTLASQTSTTMLQNMELPRNVLVGPTPLANPPLPGSFPNNTGLNPQNPTVPVPAMGTVLEDNKESVNIPQDSDCQNAQGRKEQVNTELKVVPTQEA

KMAVPEDQSKKDGQPLDPNKLPSVEENKNLMSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLEVTPPVVSGEDLRKASVIPTLQDPPSKEPSTSLSSP

HSSEPCSTLARSELSEVSSNTAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSSNTSAALPTHLQSALMSTVVTMPNVGNKVMVSEGQSAAQSN

ARPQFITPVFINSSSIIQVMKGSQPSTIPATPLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVTPNVPSSSPAPNIQTGRPLVLSSRATPVQLPSPPCTS

SPVVAPNPSVQQVKELNPDEASPQTNTSADQSTLPPSQPTTVVSPLLTNSPGSSANRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADG

ETEGPGLEITTPGLMGTEQCSTELDSKTPTPSAPTLLKMTSSPMGPSSTSTGPILPGGALPTSVRSIVTTLVPSELISTAPTTKGNHGGVTSEPLAGGLV

EEKVGSHPELLPSIA APSQNLAPKETPATALQGSVARPE ELEANAAIASGQS SCEPKEIVEKSKTLTSRRNSRTEEPTMASESVENGHRKRSSRPAS

ASSSTKD DITGAVQSKRRKSK
Transcript ENSMUST00000109669
Sequence
AATTCTGATTGGTTGCTACTTTGACCTATAAGCCCTAAAGATGCCACCTTGCTTGGACTTAGAGGATGATCTGGATAAATGATAATTAAGACATTTTG -

 UNI27644 - GTTTACTTACTGTTCACTTTGCATATACTTCTGGAATAATACACCATGGTTTTGGATGACCTTCCAAACTTTGAAGACATCTATACTT

CCTTGTGTTCATCTACAATGGGCGACTCAGAGGTGGAGTTTGACTCTGGACTAGAAGATGATGACACGAAAAGTGATAGTATTTTGGAGGATTCCACAAT

TTTTGTAGCCTTCAAAGGAAATATAGATGATAAAGACTTCAAATGGAAACTGGATGCAATATTAAAGAATGTGCCCAACTTGTTACACATGG - UNI27

644 - AATCCAGCAAGCTAAAGGTACAGAAGGTGGAGCCCTGGAACAGCGTGCGAGTCACATTCAACATCCCCCGGGAAGCAGCAGAACGGCTACGGAT

CCTGGCTCAGAGCAACAACCAGCAGCTTCGGGACCTGGGGATTCTCTCCGTTCAGATTGAAG GGGAAGGTGCTATCAACCTGGCTTTGGGTCAGAACCG

AAGCCAAGATGTGAGAATGAATGGACCTGTGGCATCTGGAAATTCCGTTAGGATGGAGGCAGGATTTCCCATGGCAAGTGGTCCAG GTCTAATAAGGAT

GACGAGCCCTGCCGCTGTTATGACGCCCCAGGGCGGGAACATGTCATCTTCCATGATGGCACCAGGCCCCAATCCAGAACTGCAACCCAGGACTCCTCGC

CCTGCTTCTCAGTCAG ATGCAATGGATCCACTTCTCTCTGGACTCCATATACAGCAACAGAGTCATCCCTCAGGATCTTTACCTCCAGCGCATCACTCA

ATGCAGCCTGTTCCTGTGAACAGACAAATGAACCCAGCTAATTTTCCCCAGCTGCAGCAGCAGCAGCAGCAACAGCAGCAGCAACAGCAACAGCAGCAAC

AGCAACAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGCAGCAACAGTTGCAGACAAGACCTCTACAGCAACATCAGCAACAGCCACAGGGGATTCG

ACCACAGTTTACTGCTCCAACTCAGGTGCCTGTTCCTCCAGGCTGGAACCAGCTGCCTTCTGGAGCCTTACAGCCTCCACCAGCCCAGGGATCTCTGGGC

ACAATGACTACAAATCAAGGGTGGAAGAAGGCTCCCTTGCCTAGCCCAATGCAAGCGCAACTTCAGGCAAGACCTTCCTTAGCTACGGTACAGACACCTT

CTCACCCTCCCCCTCCTTATCCTTTTGGCAGCCAACAAGCCTCACAAGCCCATACAAACTTTCCTCAAATGAGCAACCCAGGCCAGTTCACAGCTCCTCA

GATGAAGGGCTTGCAGGGAGGGCCCTCCAGGGTCCCAACCCCCCTGCAACAGCCCCACCTCACCAACAAGTCTCCTGCCTCCTCACCCTCCTCCTTTCAG

CAGGGATCTCCTGCATCCTCCCCAACGGTTAACCAAACTCAGCAGCAGATGGGACCAAGGCCACCTCAAAATAACCCACTTTCCCAGGGATTTCAGCAGC

CTGTCAGCTCTCCAGGTCGGAATCCTATGGTTCAACAGGGAAATGTGCCACCTAATTTCATGGTGATGCAGCAGCAACCACCAAACCAGGGGCCACAGAG

TTTACATCCAGGCCTAGGAGGTGAGGAACACTGAAGCTATTTGTGTTGGTAAATTTACTGGAGATAGATTTGAGTGGAATGTCAGTTTTTAGTATTAATG

GAGGGAGTGAAATAAGGATATAAACATTTTGTTTTGTGATAATGGTAATGACACTTGGTAGAGCTTAGTTAACGTAATGTATTTTTATCTTGATATACTA

TATAACATCTTACTGGTTAAATATAAGCTAGCTCTCTGGATAAAAATGCAGGTAAAATTGAAAATAGAGATGTTCATTCTGTTTCAAATTATTTTTACTT

AATTTTGTACTAGTAATGTCCAGACCAAACATGTATTTTATTAGTAATTTAAACTTCTTGTTTGTTGACGGATTAAGATTATAATAAGTAGAGCAGAAAT

GAAAGGATAAGTACAGGTTTTATTGGGGACAATGCCCTTCTACGTAGCAATCTTGATAATCCTAGTTAGTAACATAGTAAGCATGGTGGTTTTTAAGTTT

GATTAAAGTATTAAAGGGGACTAAGTTCAAAAATCATTACTTATGTAGTTTTATAATGCCAATGCCTGCTCCTTAGAGAGGGAATTCCACTAGTTATACC

TAAAGGAGATTTATTTATTTATTTTGTAAGGTGCCTCTTGTATGAAGAAAAAGCAATGGAGCTTAATGTGTGAGAGGTAAAACGATTCCAGTAAAACTTA

TTCATCTCCA
Translation
 - UNI27644 - MVLDDLPNFEDIYTSLCSSTMGDSEVEFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKDFKWKLDAILKNVPNLLHME - UNI2

7644 - ESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLRDLGILSVQIEG GEGAINLALGQNRSQDVRMNGPVASGNSVRMEAGFPMAS

GPG GLIRMTSPAAVMTPQGGNMSSSMMAPGPNPELQPRTPRPASQSD DAMDPLLSGLHIQQQSHPSGSLPPAHHSMQPVPVNRQMNPANFPQLQQQQQ

QQQQQQQQQQQQQQQQQQQQQQQQQQQLQTRPLQQHQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTTNQGWKKAPLPSPMQAQLQA

RPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKGLQGGPSRVPTPLQQPHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQ

NNPLSQGFQQPVSSPGRNPMVQQGNVPPNFMVMQQQPPNQGPQSLHPGLGGEEH

For any suggestions or comments, please send an email to unitrap@crg.es