Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038383 (Pigu)
Chromosomal location
Chr 2: 155073242 - 155183160 (-)
Description
phosphatidylinositol glycan anchor biosynthesis, class U Gene [Source:MGI (curated);Acc:Pigu-001]
RefSeq_dna
NM_001004721 
RefSeq_peptide
NP_001004721.1 
MGI
MGI:3039607 
Uniprot/SWISSPROT
Q8K358 
Uniprot/SPTREMBL
Q3TRB7 Q3TAA8 
Human Ortholog
ENSG00000101464 (CDC91L1)
Omim not available
UniTrap UNI35445
Vector Insertion
Chr 2: 155171383 - 155183161
Public Clones IST12398B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24874
Vector Insertion
Chr 2: 155162478 - 155171383
Public Clones not available
Private Clones OST202654 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28230
Vector Insertion
Chr 2: 155140336 - 155154316
Public Clones IST12758C4 (tigm)
Private Clones OST36572 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28405
Vector Insertion
Chr 2: 155104386 - 155118425
Public Clones not available
Private Clones OST31865 (lexicon) OST9547 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099167
Sequence
GCATTGCCTGCGCGCCCGCCTCAGTTATCATGGCGGCTCCCTTGGCCCTGGTGCTTGTGGTGGCCGTGACCGTGAGGGCGGCCTTGTTTCGCTCCAGTTT

GGCCGAGTTCATTTCCGAGAGGGTGGAGGTGGTGTCCCCACTGAGCTCTTGGAAGAGAG - UNI35445 - TGGTTGAAGGCCTTGCACTGTTGGATC

TGGGAGTGTCTCCATATTCTGGAGCAGTATTTCACGAA - UNI24874 - - UNI35445 - ACTCCATTAATAATATACCTCTTTCATTTCCTAAT

TGACTATGCAGAATTGGTATTTATG ATAACAGATGCCCTCACTGCTATTGCCCTGTATTTTGCAATTCAGGACTTCAATAAAGTTGTG TTTAAAAAGC

AGAAGCTTCTCCTAGAGCTGGACCAGTATGCTCCAGATGTGGCTGAACTCATCCGAACCCCCATGGAAATGCGCTACATCCCTCTGAAAGTGGCCCTGTT

 CTATCTCCTAAATCCCTACACGATCTTGTCTTGTGTTGCCAAGTCTACCTGCGCCATCAACAACACCCTCATTGCTTTCTTCATTTTGACCACAATAAA

AG - UNI28230 - GCAGCGTTTTCCTCAGTGCTGTTTTTCTTGCCTTAGCAACATACCAGTCTCTGTACCCAGTCACCCTGTTTGCCCCAGGACTTC

TCTATCTCCTCCAG CGGCAGTACATCCCTGTTAAAGTGAAGAGCAAAGCCTTCTGGATCTTCTCGTGGGAGTACGCCATGATGTACACAGGAAGCCTGG

TGGTGATAGTTTGCCTCTCTTTCTTCCTTCTCAGCTCCTGGGACTTCATCCCTGCAGTCTATGGTTTCAT ACTCTCTGTTCCAGATCTCACTCCAAACA

TTGGTCTTTTCTGGTACTTCTTTGCAGAGATGTTTGAGCACTTCAGCCTCTTTTTTGTCTGCGTGTTTCAGATCAACGTCTTCTTCTACACAGTTCCATT

AGCCATCAAATTAAA GGAGCATCCCATCTTCTTCATGTTCATTCAGATTGCCATCATCTCTATCTTCAAGTCCTATCCAACTGTGGGGGATGTGGCCCT

CTACATGGCTTTCTTCCCTGTGTGGAACCATCTCTACAGAT TCCTGCGGAACATCTTCGTCCTCACCTGCATCATCATCGTCTGCTCTCTTCTCTTCCC

TGTCCTGTGGCACCTATGGATTTATGCAGGAAGTGCCAACTCTAATTTCTTTTATGCCATCACACTGACCTTCAATGTTGGGCAG - UNI28405 - A

TGTACAAGAATACAACACTCATATACACAAAGAGGACGAAAAGGAGGAAGAAAGAAAAGAGGTCCACTTACACTGAGACATACCAGACATAA
Translation
MAAPLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRV - UNI35445 - VVEGLALLDLGVSPYSGAVFHE - UNI24874 - - UNI3

5445 - TPLIIYLFHFLIDYAELVFM ITDALTAIALYFAIQDFNKVV FKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALF FYLLNPYTILSC

VAKSTCAINNTLIAFFILTTIKG - UNI28230 - GSVFLSAVFLALATYQSLYPVTLFAPGLLYLLQ RQYIPVKVKSKAFWIFSWEYAMMYTGSLV

VIVCLSFFLLSSWDFIPAVYGFI ILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTVPLAIKLK KEHPIFFMFIQIAIISIFKSYPTVGD

VALYMAFFPVWNHLYRF FLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQ - UNI28405 - MYKNTTLIYTKRTKRRKKEK

RSTYTETYQT
Transcript ENSMUST00000077626
Sequence
GCATTGCCTGCGCGCCCGCCTCAGTTATCATGGCGGCTCCCTTGGCCCTGGTGCTTGTGGTGGCCGTGACCGTGAGGGCGGCCTTGTTTCGCTCCAGTTT

GGCCGAGTTCATTTCCGAGAGGGTGGAGGTGGTGTCCCCACTGAGCTCTTGGAAGAGAG - UNI35445 - TGGTTGAAGGCCTTGCACTGTTGGATC

TGGGAGTGTCTCCATATTCTGGAGCAGTATTTCACGAA - UNI24874 - - UNI35445 - ACTCCATTAATAATATACCTCTTTCATTTCCTAAT

TGACTATGCAGAATTGGTATTTATG ATAACAGATGCCCTCACTGCTATTGCCCTGTATTTTGCAATTCAGGACTTCAATAAAGTTGTG TTTAAAAAGC

AGAAGCTTCTCCTAGAGCTGGACCAGTATGCTCCAGATGTGGCTGAACTCATCCGAACCCCCATGGAAATGCGCTACATCCCTCTGAAAGTGGCCCTGTT

 CTATCTCCTAAATCCCTACACGATCTTGTCTTGTGTTGCCAAGTCTACCTGCGCCATCAACAACACCCTCATTGCTTTCTTCATTTTGACCACAATAAA

AG - UNI28230 - GCAGCGTTTTCCTCAGTGCTGTTTTTCTTGCCTTAGCAACATACCAGTCTCTGTACCCAGTCACCCTGTTTGCCCCAGGACTTC

TCTATCTCCTCCAG CGGCAGTACATCCCTGTTAAAGTGAAGAGCAAAGCCTTCTGGATCTTCTCGTGGGAGTACGCCATGATGTACACAGGAAGCCTGG

TGGTGATAGTTTGCCTCTCTTTCTTCCTTCTCAGCTCCTGGGACTTCATCCCTGCAGTCTATGGTTTCAT ACTCTCTGTTCCAGATCTCACTCCAAACA

TTGGTCTTTTCTGGTACTTCTTTGCAGAGATGTTTGAGCACTTCAGCCTCTTTTTTGTCTGCGTGTTTCAGATCAACGTCTTCTTCTACACAGTTCCATT

AGCCATCAAATTAAA GGAGCATCCCATCTTCTTCATGTTCATTCAGATTGCCATCATCTCTATCTTCAAGTCCTATCCAACTGTGGGGGATGTGGCCCT

CTACATGGCTTTCTTCCCTGTGTGGAACCATCTCTACAGAT TCCTGCGGAACATCTTCGTCCTCACCTGCATCATCATCGTCTGCTCTCTTCTCTTCCC

TGTCCTGTGGCACCTATGGATTTATGCAGGAAGTGCCAACTCTAATTTCTTTTATGCCATCACACTGACCTTCAATGTTGGGCAG - UNI28405 - A

TCCTGCTCATCTCTGACTACTTCTATGCCTTCCTGCGGCGGGAGTATTACCTCACACACGGCCTCTACTTGACTGCCAAGGACGGCACTGAGGCCATGCT

TGTGCTCAAGTAGCCCTGGCTGGCACAGCGCTGCATGGACAAGAGGGGGAAGGGCCAGAAGCTGGGCCAGGTCCCTCATCCAGAGTTGCCAGCAGGCGCG

TCCTCAGGCAGAAGAAGTTCAAGTCCAGGGTCACAAATCTCTGGCACCAAAGGGGACTCATAGCTGGCAACAAGGCCCATGGGGAGAAGCTAGGAGCACC

CCACTTGGACCCCCACTTTGTGACTGTGCACAGAAAGGAAGCAGCCGGTGAGCAGGGCTTTATAGGTTGTGACTACTTAATAAATGTGTGGATCTTTTTT

TTTTC
Translation
MAAPLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRV - UNI35445 - VVEGLALLDLGVSPYSGAVFHE - UNI24874 - - UNI3

5445 - TPLIIYLFHFLIDYAELVFM ITDALTAIALYFAIQDFNKVV FKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALF FYLLNPYTILSC

VAKSTCAINNTLIAFFILTTIKG - UNI28230 - GSVFLSAVFLALATYQSLYPVTLFAPGLLYLLQ RQYIPVKVKSKAFWIFSWEYAMMYTGSLV

VIVCLSFFLLSSWDFIPAVYGFI ILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTVPLAIKLK KEHPIFFMFIQIAIISIFKSYPTVGD

VALYMAFFPVWNHLYRF FLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQ - UNI28405 - ILLISDYFYAFLRREYYLTH

GLYLTAKDGTEAMLVLK

For any suggestions or comments, please send an email to unitrap@crg.es