Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038393 (Txnip)
Chromosomal location
Chr 3: 96361880 - 96365780 (+)
Description
thioredoxin interacting protein Gene [Source:MGI (curated);Acc:Txnip-001]
RefSeq_dna
NM_023719 NM_001009935 
RefSeq_peptide
NP_076208.1 NP_001009935.1 
UniGene
Mm.410189 Mm.431846 Mm.476699 
MGI
MGI:1889549 
Uniprot/SWISSPROT
Q8BG60 
Uniprot/SPTREMBL
Q91X82 
Human Ortholog
ENSG00000117289 (TXNIP)
Omim not available
UniTrap UNI15677
Vector Insertion
Chr 3: 96363359 - 96363511
Public Clones PST4840-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049093
Sequence
GACACTCTCCTCCTCTGGTCTCGGGGTTTCCAGAGTTTCTCCAGTTGCGGAAGACAGCTGTTATTTTTCTCCTGAAAGCTTTTGGCACAGCCGGCAGGCT

GAAACTTCCAGGCACCTTTTGGAAAAGTTGTTAGGGTTTGTTTGAAGCTTTCTTTACATTTTCGTTTGGGTTTTCAAGCCCTGACTTTACGGAGGCGAGC

TCTTCGTTTGCTTTGAAGGGTTCTTAAAGATTTTTTTCCTCTCCGGCTTTCGTTTTTCTTGAACCCACTCGGCTCAATCATGGTGATGTTCAAGAAGATC

AAGTCTTTTGAGGTGGTCTTCAACGACCCCGAGAAGGTGTACGGCAGCGGGGAGAAGGTGGCCGGACGGGTAATAGTGGAAGTGTGTGAAGTTACCCGAG

TCAAAGCCGTCAGGATCCTGGCTTGCGGCGTGGCCAAGGTCCTGTGGATGCAAGGGTCTCAGCAGTGCAAACAGACTTTGGACTACTTGCGCTATGAAGA

CACACTTCTCCTAGAAGAGCAGCCTACAG GTGAGAACGAGATGGTGATCATGAGGCCTGGAAACAAATATGAGTACAAGTTCGGCTTCGAGCTTCCTCA

AGG GCCCCTGGGAACATCCTTTAAAGGAAAATATGGTTGCGTAGACTACTGGGTGAAGGCTTTTCTCGATCGCCCCAGCCAGCCAACTCAAGAGGCAAA

GAAAAACTTCGAAGTGATGGATCTAGTGGATGTCAATACCCCTGACCTAATG GCACCAGTGTCTGCCAAAAAGGAGAAGAAAGTTTCCTGCATGTTCAT

TCCTGATGGACGTGTGTCAGTCTCTGCTCGAATTGACAGAAAAGGATTCTGTGAAG - UNI15677 - GTGATGACATCTCCATCCATGCTGACTTTG

AGAACACGTGTTCCCGAATCGTGGTCCCCAAAGCGGCTATTGTGGCCCGACACACTTACCTTGCCAATGGCCAGACCAAAGTGTTCACTCAGAAGCTGTC

CTCAGTCAGAGGCAATCACATTATCTCAGGGACTTGCGCATCGTGGCGTGGCAAGAGCCTCAGAGTGCAGAAGATCAGACCATCCATCCTGGGCTGCAAC

ATCCTCAAAGTCGAATACTCCTTGCTG ATCTACGTCAGTGTCCCTGGCTCCAAGAAAGTCATCCTTGATCTGCCCCTAGTGATTGGCAGCAGGTCTGGT

CTGAGCAGCCGGACATCCAGCATGGCCAGCCGGACGAGCTCTGAGATGAGCTGGATAGACCTAAACATCCCAGATACCCCAGAAG CTCCTCCTTGCTAT

ATGGACATCATTCCTGAAGATCACAGACTAGAGAGCCCCACCACCCCTCTGCTGGACGATGTGGACGACTCTCAAGACAGCCCTATCTTTATGTACGCCC

CTGAGTTCCAGTTCATGCCCCCACCCACTTACACTGAG GTGGATCCGTGCGTCCTTAACAACAACAACAACAACAACAACGTGCAGTGAGCCTGCAGGA

AATGAAGCATCTGTATTAGCGCATTTCTTTCTGCCTCTCTGCTTGAACTCCAGTGTTTCAGAGACTCAGTCTCTACAGCGGGGAACGGGTACACCCCAGC

CGCTGACTCCTCAAGATGGGTGGCAATCAGTAGGCGGGTCTCCGGCTTCAAGTGGTGCAGACCAGTGCCCGCACTGTGGCATAGGAGTGTTTGCTGGGTG

GATGTCAGAACACTCTTAGAAAAATTGAGACCTGACCACTTTCTCGGATGTTGGAAATGAAGAACTTGTTTGTGTTGACTGAGTCAGGGCACTGCTGACC

TTCTGGCGTTGTCTTTCCAAGGTTTTTGTTTTAAAGGGACTTTTAAATTGTCTAAAATATCAGTAGACCATCATCTGTGCCATGGGGGACAGAGCCAATT

TCAAGTCATGGCCAAAATTTTGTAAGAGGAGTGTTTTTGTGTGTTTTTTAAAGTCAGTGTTCCTTTTTTATATCTTTACAAAGAAAAGACCTTCCACGGC

TGGTGAGCACGCAGCCTGTGAAATTCGGGGCAGCTGCTCCAAGTTGACTTCACCCTGGGAGCAGTAGTAGCTGTGCCCACTGACGGCCATAAAAGCCATT

TTACAGCCAGTTGCACTGTGTTCTCTTGTAAGCATAATCAGATGGGAGAATCTGTTATTTCCCTGTAACCCCTTGGAATTGATTCTAAGGTGATGTTCTT

AGCACTTTAGCTTGTCAATTTTGTTTTAGTCTCCGTTATAGATGTAAGCTCCACCAGTCTCTTAAGGATTAAGCCCAGTGACTTGGAGGGTGGGGGTTAG

GGTCTCTATCCCTGAACATTGTAGACCCAGGCTGGCCTGAGAGATCCACCTGCCTCTGCCTCCTGAGTGCTGCGATCAAAGGCCCAGCTTGGTTATTGCT

TTTGAGGCTTTCTCCCAACGCACAGACTTGTGTAATTCTAACACTAATCCTGTGAAGGGTTGTGGTTGACAGCTGGAGCCTGGGTGACATTCTACATTGA

GATGCCCCAGCACTGATCGGGGCACAGAAGCCCCCAGACCCCATTTCCTGTCCAGTGTTGGGAGAAAGTGCTGCTTTCACTGTGGCCTCAGCCCTGGCTC

GGAAGCTCACTAAGCCTTAGCACTTTGTCCTGTGTCAGCTCCACCTGAGAACTGTGCAGCCAGAATGTCTGCGAGCTGATGGAGGTTTCGGTTTTGTTGT

TTTTGTATTTTGTGTATCTTTTTGTATGATTAAAAACTATATTTTCTACTTATCCAAATATATTTTCACCCCAAAGTGGGGTTATCCTTTGTAAAAAAAA

ATAAAGTTTTTTAATGAC
Translation
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTG GENEMVIMRPGNKYE

YKFGFELPQG GPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLM APVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEG - 

UNI15677 - GDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLL IY

VSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEA APPCYMDIIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPPT

YTE VDPCVLNNNNNNNNVQ
Transcript ENSMUST00000074519
Sequence
GACACTCTCCTCCTCTGGTCTCGGGGTTTCCAGAGTTTCTCCAGTTGCGGAAGACAGCTGTTATTTTTCTCCTGAAAGCTTTTGGCACAGCCGGCAGGCT

GAAACTTCCAGGCACCTTTTGGAAAAGTTGTTAGGGTTTGTTTGAAGCTTTCTTTACATTTTCGTTTGGGTTTTCAAGCCCTGACTTTACGGAGGCGAGC

TCTTCGTTTGCTTTGAAGGGTTCTTAAAGATTTTTTTCCTCTCCGGCTTTCGTTTTTCTTGAACCCACTCGGCTCAATCATGGTGATGTTCAAGAAGATC

AAGTCTTTTGAGGTGGTCTTCAACGACCCCGAGAAGGTGTACGGCAGCGGGGAGAAGGTGGCCGGACGGGTAATAGTGGAAGTGTGTGAAGTTACCCGAG

TCAAAGCCGTCAGGATCCTGGCTTGCGGCGTGGCCAAGGTCCTGTGGATGCAAGGGTCTCAGCAGTGCAAACAGACTTTGGACTACTTGCGCTATGAAGA

CACACTTCTCCTAGAAGAGCAGCCTACAG CAGGTGAGAACGAGATGGTGATCATGAGGCCTGGAAACAAATATGAGTACAAGTTCGGCTTCGAGCTTCC

TCAAGG GCCCCTGGGAACATCCTTTAAAGGAAAATATGGTTGCGTAGACTACTGGGTGAAGGCTTTTCTCGATCGCCCCAGCCAGCCAACTCAAGAGGC

AAAGAAAAACTTCGAAGTGATGGATCTAGTGGATGTCAATACCCCTGACCTAATG GCACCAGTGTCTGCCAAAAAGGAGAAGAAAGTTTCCTGCATGTT

CATTCCTGATGGACGTGTGTCAGTCTCTGCTCGAATTGACAGAAAAGGATTCTGTGAAG - UNI15677 - GTGATGACATCTCCATCCATGCTGACT

TTGAGAACACGTGTTCCCGAATCGTGGTCCCCAAAGCGGCTATTGTGGCCCGACACACTTACCTTGCCAATGGCCAGACCAAAGTGTTCACTCAGAAGCT

GTCCTCAGTCAGAGGCAATCACATTATCTCAGGGACTTGCGCATCGTGGCGTGGCAAGAGCCTCAGAGTGCAGAAGATCAGACCATCCATCCTGGGCTGC

AACATCCTCAAAGTCGAATACTCCTTGCTG ATCTACGTCAGTGTCCCTGGCTCCAAGAAAGTCATCCTTGATCTGCCCCTAGTGATTGGCAGCAGGTCT

GGTCTGAGCAGCCGGACATCCAGCATGGCCAGCCGGACGAGCTCTGAGATGAGCTGGATAGACCTAAACATCCCAGATACCCCAGAAG CTCCTCCTTGC

TATATGGACATCATTCCTGAAGATCACAGACTAGAGAGCCCCACCACCCCTCTGCTGGACGATGTGGACGACTCTCAAGACAGCCCTATCTTTATGTACG

CCCCTGAGTTCCAGTTCATGCCCCCACCCACTTACACTGAG GTGGATCCGTGCGTCCTTAACAACAACAACAACAACAACAACGTGCAGTGAGCCTGCA

GGAAATGAAGCATCTGTATTAGCGCATTTCTTTCTGCCTCTCTGCTTGAACTCCAGTGTTTCAGAGACTCAGTCTCTACAGCGGGGAACGGGTACACCCC

AGCCGCTGACTCCTCAAGATGGGTGGCAATCAGTAGGCGGGTCTCCGGCTTCAAGTGGTGCAGACCAGTGCCCGCACTGTGGCATAGGAGTGTTTGCTGG

GTGGATGTCAGAACACTCTTAGAAAAATTGAGACCTGACCACTTTCTCGGATGTTGGAAATGAAGAACTTGTTTGTGTTGACTGAGTCAGGGCACTGCTG

ACCTTCTGGCGTTGTCTTTCCAAGGTTTTTGTTTTAAAGGGACTTTTAAATTGTCTAAAATATCAGTAGACCATCATCTGTGCCATGGGGGACAGAGCCA

ATTTCAAGTCATGGCCAAAATTTTGTAAGAGGAGTGTTTTTGTGTGTTTTTTAAAGTCAGTGTTCCTTTTTTATATCTTTACAAAGAAAAGACCTTCCAC

GGCTGGTGAGCACGCAGCCTGTGAAATTCGGGGCAGCTGCTCCAAGTTGACTTCACCCTGGGAGCAGTAGTAGCTGTGCCCACTGACGGCCATAAAAGCC

ATTTTACAGCCAGTTGCACTGTGTTCTCTTGTAAGCATAATCAGATGGGAGAATCTGTTATTTCCCTGTAACCCCTTGGAATTGATTCTAAGGTGATGTT

CTTAGCACTTTAGCTTGTCAATTTTGTTTTAGTCTCCGTTATAGATGTAAGCTCCACCAGTCTCTTAAGGATTAAGCCCAGTGACTTGGAGGGTGGGGGT

TAGGGTCTCTATCCCTGAACATTGTAGACCCAGGCTGGCCTGAGAGATCCACCTGCCTCTGCCTCCTGAGTGCTGCGATCAAAGGCCCAGCTTGGTTATT

GCTTTTGAGGCTTTCTCCCAACGCACAGACTTGTGTAATTCTAACACTAATCCTGTGAAGGGTTGTGGTTGACAGCTGGAGCCTGGGTGACATTCTACAT

TGAGATGCCCCAGCACTGATCGGGGCACAGAAGCCCCCAGACCCCATTTCCTGTCCAGTGTTGGGAGAAAGTGCTGCTTTCACTGTGGCCTCAGCCCTGG

CTCGGAAGCTCACTAAGCCTTAGCACTTTGTCCTGTGTCAGCTCCACCTGAGAACTGTGCAGCCAGAATGTCTGCGAGCTGATGGAGGTTTCGGTTTTGT

TGTTTTTGTATTTTGTGTATCTTTTTGTATGATTAAAAACTATATTTTCTACTTATCCAAATATATTTTCACCCCAAAGTGGGGTTATCCTTTGTAAAAA

AAAATAAAGTTTTTTAATGAC
Translation
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTA AGENEMVIMRPGNKY

EYKFGFELPQG GPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLM APVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEG -

 UNI15677 - GDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLL I

YVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEA APPCYMDIIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPP

TYTE VDPCVLNNNNNNNNVQ
Transcript ENSMUST00000090771
Sequence
GACACTCTCCTCCTCTGGTCTCGGGGTTTCCAGAGTTTCTCCAGTTGCGGAAGACAGCTGTTATTTTTCTCCTGAAAGCTTTTGGCACAGCCGGCAGGCT

GAAACTTCCAGGCACCTTTTGGAAAAGTTGTTAGGGTTTGTTTGAAGCTTTCTTTACATTTTCGTTTGGGTTTTCAAGCCCTGACTTTACGGAGGCGAGC

TCTTCGTTTGCTTTGAAGGGTTCTTAAAGATTTTTTTCCTCTCCGGCTTTCGTTTTTCTTGAACCCACTCGGCTCAATCATGGTGATGTTCAAGAAGATC

AAGTCTTTTGAGGTGGTCTTCAACGACCCCGAGAAGGTGTACGGCAGCGGGGAGAAGGTGGCCGGACGGGTAATAGTGGAAGTGTGTGAAGTTACCCGAG

TCAAAGCCGTCAGGATCCTGGCTTGCGGCGTGGCCAAGGTCCTGTGGATGCAAGGGTCTCAGCAGTGCAAACAGACTTTGGACTACTTGCGCTATGAAGA

CACACTTCTCCTAGAAGAGCAGCCTACAG CAGGTGAGAACGAGATGGTGATCATGAGGCCTGGAAACAAATATGAGTACAAGTTCGGCTTCGAGCTTCC

TCAAGG GCCCCTGGGAACATCCTTTAAAGGAAAATATGGTTGCGTAGACTACTGGGTGAAGGCTTTTCTCGATCGCCCCAGCCAGCCAACTCAAGAGGC

AAAGAAAAACTTCGAAGTGATGGATCTAGTGGATGTCAATACCCCTGACCTAATG GCACCAGTGTCTGCCAAAAAGGAGAAGAAAGTTTCCTGCATGTT

CATTCCTGATGGACGTGTGTCAGTCTCTGCTCGAATTGACAGAAAAGGATTCTGTGAAG - UNI15677 - GTGATGACATCTCCATCCATGCTGACT

TTGAGAACACGTGTTCCCGAATCGTGGTCCCCAAAGCGGCTATTGTGGCCCGACACACTTACCTTGCCAATGGCCAGACCAAAGTGTTCACTCAGAAGCT

GTCCTCAGTCAGAGGCAATCACATTATCTCAGGGACTTGCGCATCGTGGCGTGGCAAGAGCCTCAGAGTGCAGAAGATCAGACCATCCATCCTGGGCTGC

AACATCCTCAAAGTCGAATACTCCTTGCTG ATCTACGTCAGTGTCCCTGGCTCCAAGAAAGTCATCCTTGATCTGCCCCTAGTGATTGGCAGCAGGTCT

GGTCTGAGCAGCCGGACATCCAGCATGGCCAGCCGGACGAGCTCTGAGATGAGCTGGATAGACCTAAACATCCCAGATACCCCAGAAG CTCCTCCTTGC

TATATGGACATCATTCCTGAAGATCACAGACTAGAGAGCCCCACCACCCCTCTGCTGGACGATGTGGACGACTCTCAAGACAGCCCTATCTTTATGTACG

CCCCTGAGTTCCAGTTCATGCCCCCACCCACTTACACTGAG GTGGATCCGTGCGTCCTTAACAACAACAACAACAACAACAAC AACTCCAGTGTTTCA

Translation
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTA AGENEMVIMRPGNKY

EYKFGFELPQG GPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLM APVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEG -

 UNI15677 - GDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLL I

YVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEA APPCYMDIIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPP

TYTE VDPCVLNNNNNNNN NSSVS

For any suggestions or comments, please send an email to unitrap@crg.es