Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038417 (Fig4)
Chromosomal location
Chr 10: 40907978 - 41023047 (-)
Description
FIG4 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:2143585]
RefSeq_dna
NM_133999 
RefSeq_peptide
NP_598760.1 
UniGene
Mm.277242 
MGI
MGI:2143585 
Uniprot/SWISSPROT
Q91WF7 
Uniprot/SPTREMBL
Q3TA31 Q3TE15 Q3U2A4 
Human Ortholog
ENSG00000112367 (FIG4)
Omim 611228 - CHARCOT-MARIE-TOOTH DISEASE, TYPE 4J  
UniTrap UNI31784
Vector Insertion
Chr 10: 41005406 - 41023048
Public Clones IST12378E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27301
Vector Insertion
Chr 10: 40997321 - 41005095
Public Clones not available
Private Clones OST64300 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30214
Vector Insertion
Chr 10: 40907977 - 40940792
Public Clones D077F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043814
Sequence
GGGAATCCGGAAGCAGCCGGCGAGCCCGCTGCTGAACGTTTGGTGTTCTGACACTGTTTTTGTCAGCTGTGTCTGGTGTGCTGGAGGTCTGCGGGGTCTC

CTCGCTCTGTCTCCAGGGGGAACCCCGCCGCTGTCACGACCTGGGCCGCGGCCTGGTGCCCTGTGGCGGGGCCGCCATTGGCTGGAGCCATGCCCACGGC

CGCTGCCCCCATCATCAGCTCGGTCCAGAAGCTGGTGCTGTATGAGACCAGAGCT - UNI31784 - AGATACTTTCTAGTTGGGAGCAATCATGCAG

AAACGAAGTACCGTGTCCTGAAAATTGATAGAACAGAACCGAAGGACTTGGTGGTAATCGACGACAGG - UNI31784 - CACGTGTACACACAACAA

GAAGTGAGGGAACTTCTTGGCCGCCTGGATCTGGGAAACAGAACAAAGATGAGCCAGAAAGGATCCTCCGGGTTGTTTCGAGCCGTCTCAGCTTTTGGAG

TCGTAG - UNI27301 - GTTTTGTCAGGTTCTTAGAAGGCTACTATATTGTATTAATAACTAAGCGGAGGAAGATGGCAGACATTGGAGGTCATGCA

ATTTATAAGATTGAAGATACAAGTATGATTTATATCCCCAATGACTCTGTTCGGATTTCTCACCCCGACGAAGCTAG GTATCTAAGGATATTTCAAAAT

GTGGATCTATCTAGCAATTTTTACTTTAG TTACAGCTATGATTTGTCACACTCACTTCAGTATAATCTTACCGTCCTGCGAATGCCCCTGGAGATGTTA

AAGTCAGAAACATCCAAGGCGTGCCAGGAGAGCTTCGACATCTTTGAAGATGAAGGATTAATTACACAGGGTGGCAGTG GTGTATTTGGGATCTCTAGT

GAGCCTTATATGAAGTATGTATGGAACGGTGAACTTCTGGATATAATTAAAAACACTGTGCATCGTGACTGGCTATTGTATATCATTCATGGGTTCTGCG

GGCAGTCCA AGCTTTTGATCTATGGACGACCAGTGTATGTGACCCTAATAGCCAGGAGATCCAGTAGGTTTGCTGGGACGCGCTTTCTCAAGAGAGGCG

CAAACTGTGAG GGTGACGTTGCAAATGAGGTGGAGACCGAGCAGATCCTCTGTGATGCTTCTGTGATGTCTTTTACCGCAGGCAGTTACTCTTCTTACG

TACAAGTTAGAGGATCCGTTCCCTTATTCTGGTCCCAAGACATCTCAACTATGATGCCGAAACCACCCATTACAC TGGACCAGGCGGATCCCTTTGCAC

ACGTGGCTGCTCTTCACTTTGACCAGATGCTCCAGAGGTTCGGCTCCCCCATCATCATCTTGAACTTAGTGAAG GAGAGGGAGAAGAGAAAGCACGAAA

GGATCCTGAGTGAAGAGCTGGTGGCTGCGGTCACTTACCTGAACCAGTTCCTGCCACCGGAGCACACCATTGTCTACATCCCCTGGGACATGGCCAAGTA

CACCAAGAG TAAGCTGTGCAACGTTCTCGATCGGCTGAATGTGATTGCGGAAAGCGTGGTAAAGAAGACAGGATTCTTTGTAAACCGCCCTGATTCTTA

CTGCAGCATTTTACGGCCAGATGAAAA GTGGAATGAACTAGGAGGTCATGTGATTCCCACTGGTCGGCTCCAG ACTGGCATCCTTCGAACCAACTGTG

TGGACTGTTTGGATCGCACCAACACTGCGCAGTTCATGGTGGGCAAGTGTGCCCTGGCTTACCAGCTGTATTCCTTAGGGCTGATTGACAAGCCTAACCT

GCAGTTCGACACGGATGCAGTGAG GTTGTTTGAGGAACTCTATGAAGACCATGGAGACACCCTTTCCCTGCAGTACGGAGGCTCTCAGCTGGTTCATCG

GGTAAAGACCTACAGAAAGATAGCACCGTGGACCCAGCACTCCAAGGACATCATGCAGACTCTGTCCCGGTACTACAGCAACGCCTTCTCGG ATGCTGA

TAGACAAGATTCCATCAACCTGTTTTTGGGTGTTTTCCACCCCACAGAAGGGAAACCTCATCTCTGGGAACTCCCCACAGACTTTTACCTCCATCACAAA

AACACCATGAGCCTTTTACCCCCCAGAAGGAG TTATACTTACTGGTGGACGCCAGAGGTGGTGAAGCATCTGCCGCTGCCTTACGATGAAG TTATCTG

TGCTGCAAACTTAAAGAAGTTGATGGTGAAGAAATTTCACAGATGGGAAGAAGAGATTGATATTCACAATGAGTTCTTCCGGCCGTATGAATTGAGTAGT

TTTGATGACACCTTTTGCTTGGCCATGACAAGTTCAGCACG TGATTTTATGCCTAAAACTGTTGGCATTGATCCAAGTCCATTTACCGTGCGAAAACCA

GATGAAACTGGAAAATCTGTACTGGG GAACAAAAACACTAGAGAGGAAGCTGTCCTGCAGCGGAAGACGGCAGCCAGCGCCCCGCCACCCCCGAGCGAG

GAGGCTGTGTCCAGCAGCTCTGAGGATGACTCTGGCACCGACCGGGAAGATGAAGGCTCCATCTCTCAGCGATCCACTCCTGTGAAGATGACTGACACGG

GAGACAGTGCCAAAGCGACTGAG AATGTGGTCCAGCCCATGAAGGAAGTGTATGGAGTCAGTCTCTCCAGTAGCCTGTCAGAGGAGGATCACTCCATTT

ATGCCAG - UNI30214 - GTTTGTTCAGCTGGGGCAAAGTCAACATAAACAGGACCGAGGTAACCAGCAGCTGTGTTCCCGTTGCTCAGATGGAGTT

ATAAAACT - UNI30214 - AACTCCCATCTCAGCTTTCTCGCAAGACAACATTTATGAAGTTCAGCCTCCAAGAGTAGACAGAAAGTCTACAGAGAT

CTTCCAGGCCCATATCCAAGCTAGCCAAGGTATCATGCAGCCCCTTGGCAAAGAGGACACTGCCATGTACCGGGAGTACATCAGAAACCGCTACTTATAG

AGACGGCCTCGAGGACAGTGTCCTCTGTGAGAAGGCGTGCCCCAGATCCTGAGATGCAGCTCATTGGTAAAGGACTCCCCAGCACCTGTATCACAGCCTT

CGGTGATTCCAGCTACCAGGAATCCAGTGTTGTCTTCCAGATTTTGTAGGCACCTATACTCAAGTAGGTGCCTGTGTGTGCACACACATGCACAGGAGTG

CATACACACACATGTATGCACACACACAGTAAAAATAATAAAAGTAAAATCTTTAAAAATCAATTCATCCAAATCATGTATCTGAAACTTTTCACCTCTT

TGTACCATGCAAATGACTAATTGCAGGTAATAAAGAAATGCTGCCTCTTT
Translation
MPTAAAPIISSVQKLVLYETRA - UNI31784 - RYFLVGSNHAETKYRVLKIDRTEPKDLVVIDDR - UNI31784 - HVYTQQEVRELLGRLDL

GNRTKMSQKGSSGLFRAVSAFGVVG - UNI27301 - GFVRFLEGYYIVLITKRRKMADIGGHAIYKIEDTSMIYIPNDSVRISHPDEAR RYLRIFQ

NVDLSSNFYFS SYSYDLSHSLQYNLTVLRMPLEMLKSETSKACQESFDIFEDEGLITQGGSG GVFGISSEPYMKYVWNGELLDIIKNTVHRDWLLYII

HGFCGQSK KLLIYGRPVYVTLIARRSSRFAGTRFLKRGANCE GDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLFWSQDISTMMPKPPITL 

LDQADPFAHVAALHFDQMLQRFGSPIIILNLVK EREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAKYTKS SKLCNVLDRLNVIAESVVKK

TGFFVNRPDSYCSILRPDEK KWNELGGHVIPTGRLQ TGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVR RLFEELYEDHG

DTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSD DADRQDSINLFLGVFHPTEGKPHLWELPTDFYLHHKNTMSLLPPRRS SYTYW

WTPEVVKHLPLPYDEV VICAANLKKLMVKKFHRWEEEIDIHNEFFRPYELSSFDDTFCLAMTSSAR RDFMPKTVGIDPSPFTVRKPDETGKSVLG GN

KNTREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREDEGSISQRSTPVKMTDTGDSAKATE NVVQPMKEVYGVSLSSSLSEEDHSIYAR - UNI3

0214 - RFVQLGQSQHKQDRGNQQLCSRCSDGVIKL - UNI30214 - LTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDTAM

YREYIRNRYL

For any suggestions or comments, please send an email to unitrap@crg.es