Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038437 (Mllt6)
Chromosomal location
Chr 11: 97524726 - 97546757 (+)
Description
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6 Gene [Source:MGI (curated);Acc:Mllt6-001]
RefSeq_dna
NM_139311 
RefSeq_peptide
NP_647472.2 
UniGene
Mm.23685 
MGI
MGI:1935145 
Uniprot/SPTREMBL
B1AR10 Q8CFR8 B1AR09 Q3UPK1 Q8VHB4 
Human Ortholog
ENSG00000108292 (MLLT6)
Omim not available
UniTrap UNI26978
Vector Insertion
Chr 11: 97524995 - 97526268
Public Clones (sanger) D109G11 (ggtc) P151B04 (ggtc) E078C04 (ggtc) D021F09 (ggtc)
IST14360D3 (tigm) IST13099H7 (tigm) IST13124H12 (tigm) IST13095H11 (tigm)
IST14289F2 (tigm) IST13105H1 (tigm) IST12843H9 (tigm)
Private Clones OST80964 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5556
Vector Insertion
Chr 11: 97526349 - 97526799
Public Clones (sanger) YTA211 (baygenomics) IST13056H12 (tigm) IST10617B8 (tigm)
IST14393A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23228
Vector Insertion
Chr 11: 97526855 - 97527043
Public Clones (sanger) E021C07 (ggtc) E021D07 (ggtc)
Private Clones OST270044 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26771
Vector Insertion
Chr 11: 97527154 - 97528103
Public Clones (sanger) IST10042E4 (tigm) IST10617B8 (tigm) IST14631A6 (tigm) IST14184E11 (tigm)
IST14719F3 (tigm)
Private Clones OST98472 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37786
Vector Insertion
Chr 11: 97528208 - 97528388
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24064
Vector Insertion
Chr 11: 97528483 - 97530737
Public Clones D099G08 (ggtc) E128E11 (ggtc) D128E11 (ggtc)
Private Clones OST236138 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4878
Vector Insertion
Chr 11: 97530951 - 97531566
Public Clones AC0433 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8429
Vector Insertion
Chr 11: 97531666 - 97533770
Public Clones XH132 (baygenomics)
Private Clones OST195153 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7105
Vector Insertion
Chr 11: 97533770 - 97533907
Public Clones RRJ366 (baygenomics) RRJ373 (baygenomics) D117C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14934
Vector Insertion
Chr 11: 97533997 - 97534773
Public Clones PST12066-NR (escells) PST481-2 (escells) PST3741-NL (escells) PST481-1 (escells)
PST6646-NR (escells) IST14731A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8473
Vector Insertion
Chr 11: 97535386 - 97535751
Public Clones RRQ162 (baygenomics) RRQ163 (baygenomics) IST11830G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8168
Vector Insertion
Chr 11: 97535934 - 97536087
Public Clones RRH080 (baygenomics) IST11830H5 (tigm) IST11830G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12589
Vector Insertion
Chr 11: 97536197 - 97537452
Public Clones W065E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36403
Vector Insertion
Chr 11: 97537827 - 97538175
Public Clones IST14508D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2740
Vector Insertion
Chr 11: 97542141 - 97542859
Public Clones AK0308 (sanger) XP0445 (sanger)
Private Clones OST372413 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107586
Sequence
CCGAGGAGGAGGAAGGAGGAGGCAAAGAAAAGAAGCGGCGGCGGCGGCGGCGGAGGAGGGGGCGAGGAGGCGCGCGGCCCCCGCTCCCTCCCTCCCCCCC

TGACCCCCGACCCCCGCCGGCCGGCCCCCAGCCCCAGCCCCGGAGGGAGCTCATGGGAGTATGAAGGAGATGGTAGGAGGCTGCTGCGTATGTTCGGACG

AGAGGGGCTGGGCCGAAAACCCGCTGGTCTACTGCGATGGGCACGCGTGCAGCGTGGCCGTCCACCAAG - UNI26978 - CTTGCTATGGCATCGTC

CAGGTGCCAACAGGACCCTGGTTCTGCAGGAAATGTGAATCTCAGGAGCGTGCAGCCAGGGTG - UNI5556 - AGGTGTGAGCTGTGCCCGCACAAA

GATGGGGCATTGAAGAGGACTGACAATGGAG - UNI23228 - GCTGGGCCCATGTGGTGTGCGCCCTCTACATCCCGGAGGTGCAGTTCGCCAACGT

GCTCACGATGGAGCCCATCGTTCTGCAGTACGTGCCTCATGATCGCTTCAACAAG - UNI26771 - ACCTGTTACATCTGTGAGGAACAGGGCCGGG

AGAGCAAAGCTGCCTCGGGAGCCTGCATGACCTGTAACCGCCACGGATGCCGACAAGCTTTCCATGTCACCTG TGCCCAGATGGCTGGCCTGCTGTGTG

AGGAAGAAGTCCTGGAGGTGGACAACGTCAAGTACTGCGGCTACTGCAAATACCACTTCAGCAAGATG - UNI24064 - AAGACATCCCGGCACTCC

AGCGGGGGAGGAGGAGGAGCAGGAGGAGGCAGCAGCGGCGGGGGAGGAGGTGGCAGCAGTAGTGCCAGCGGTGGTGGAGGTGGCACCGGGGGAGGCAGCG

GCAACAGCTTCCTTAGCGGCAGGAGAAGCCGGTCAGCCTCGCCATCCACCCAGCCGGAGAAGCACCCTACCCACCATGAGAAGGGCCAGAAGAAG - UN

I4878 - AGTCGAAAGGACAAAGAACGCCTTAAACAGAAGCACAAGAAGCGGCCTGAGTCCCCCCCCAGCGTCCTCGCCCCGCCTGCGGTTCCCACTGC

TGATAAG - UNI7105 - - UNI8429 - GTCTCCTCAGCGACTTCTTCCTCCCACCATGAGGCCAGCACTCAGGAGACCTCTGAGAGTAGCAGGGA

CTCAAAGGGGAGAAAGTCTTCCAGCCATAGCCTGAGTCATAAGGACAAGAAACTGGGCACTGGGAAAGGTGTGAGCAGTTTCACCTCCGCTTCCTCCTCT

TCCTCCTCCTCTTCCTCTTCCTCCTCTTCCTCCTCTGGGGGCCCTTTTCAGCCTGCAG - UNI14934 - GCTCGTCTCTGCAGAGCTCTCCTGACTT

TGCAGCGTTCCCCAAGCTGGAACAGCCGGAGGAAGACAAATATCCCAAGCCTGCGGACCCCACCCCGCCGGCCCCTCCCTCGCCCACGGCCCCTGAGCCC

CCAAAGGCTGACCTCTTTGAACAGAAAGTTGTCTTCTCTGGCTTTGGGCCCATCATGCGCTTCACCACCACCGCCTCCAGCTCCAGCCGGGCCCGAGCCC

CTTCACCTGGAGACTATAAGTCTCCCCATATTACCGGGGCCGGGGCCTCAGCAGGCACCCACAAACGGATGCCCGCACTGAGTGCCACCCTTGGACCTGC

TGAGGAGGCCCCTGAGACCACCCTGAAGGAGAAGAAACACAAAGCCAGCAAAAGGAGCCGACACGGGCCAGGCCGACCCAAAGGGAGCAGAGGCAAGGAG

GGTGCTTCAGGCCCGACTGCCTCCCTCCCTGCGGCTCAGCTCGCTGGCTTCACTGCCACTGCGGCCTCACCCTTCTCTGGGGGCTCCCTGGTCAGCGCTG

GCCTGGGGGGTCTGGCCTCCCGTACCTTTGGGCCTTCAGGAAGCTTGCCCAGCTTGAGCTTAGAGTCATCTCTGCTGGGGGCAG - UNI8473 - GCA

TCTATACCAGTAATAAGGATCCCATCTCTCATGGTGGAGGGATGCTGCGGGCTGTCTGCAGCACCCCACTCTCTTCCAGCCTGCTGGGGCCCACAGGAAC

CTCAGCCTTGCCGCGCCTCAGCCGGTCCCCCTTCACCAGCACCCTTGCATCCTCTTCTGCTTCCATCTCCACCACTCAG - UNI8168 - GTGTTTTC

TCTGGCTGGCTCAACCTTCAGCCTCCCTTCATCCCACATCTTTGGAACCCCCATGGGCACTGTTAACCCCCTCCTCACCCAAGCGGAGAGCAGCCACACA

G - UNI12589 - AGCCAGACCTAGAAGACTGCAGCTTCCGGTGTCACGGGACCTCCCCCCAGGAGAGTCTCTCTTCCAT GTCTCCCATCAGCAGCC

TCCCTGCGCTCTTCGACCAGACGTCGGCGCCCTGTGCGGGTGGCCAGTTAGACTCCACAGCCCCCGGGACAACCAACATGGAGCAGCTGCTGGAGAAGCA

GGGTGACGGAGAGGCTGGTGTCAACA - UNI36403 - TTGTGGAGATGCTGAAGGCCCTGCATGCGCTGCAGAAGGAAAACCAGCGGCTGCAGGAGC

AGATCCTTAGCCTGACAGCGAAGAAGGAGCGGCTCCAAGTCCTCAACGTGCAGCTCTCCGTTCCCTTCCCCGCCCTGCCTGCTGCCCTGCCGGCCACTAA

CGGCCCCATCCCAGGGCCCTATGGACTGCTTCCTCAAG CTGGCAGCAGTGACTCCCTGAGCGTCAGCAAGAGCCCTCCCGGGAAGAACAGCCTCGGCCT

GGACAATTCCCTGTCCACCTCTTCCGAG GACCCACACTCAGGCTGCCCGAGCCGCAGCAGCTCTTCGCTCTCCTTCCACAGCACGCCCCCACCGCTGCC

CCTGCTCCAGCAGAGCCCGGCTACTCTGCCCTTGGCCCTGCCTGGGGCTCCTGCCCCACTCCCACCCCAGCCACAGAACGGGCTGGGCCGGGCGCCTGGA

GCAACGGGGCTGGGAGCCATGCCCATGGCTGAGGGGCTGTTGGGTGGGCTGGCAGGCAGCGGGAGCCTGCCCCTCAATGGGCTTCTGGGAGGGTTGAATG

GGGCTGCTGCTCCCAACCCCGCGGGCTTGAGCCAGGCTGGCGGGGCCCCCACGCTTCAACTGCCAGGTTGTCTCAACAG CCTGACAGAGCAGCAGAGAC

ACCTCCTTCAGCAGCAAGAGCAGCAGCTGCAGCAACTGCAGCAGCTCCTGGCCTCTCCACAGCTGACCCCA GAGCACCAGACTGTGGTCTACCAGATGA

TCCAGCAGATGCAGCAGAAACGGGAGCTGCAGCGGCTACAGATGGCTGGGGGCTCTCAGCTGCCCATGGCCAGTCTACTGGCTGGAAGCTCCACCCCACT

GCTGTCCGCGGGCACCCCTGGCCTGCTGCCCACAGCATCAGCCCCACCCCTGCTGCCTGCTGGAGCCCTGGTGGCCCCTTCACTGGGCAGCAATACAAGT

CTAATGGCTGCAGCGGCTGCAGCCGCAGCGGTGGCGGCGGCAGGCGGACCTCCAGTCCTCACTGCTCAGACCAACCCTTTTCTCAGCCTGCCTGGGGCAG

ACGCCAGTGGGAATGGCCCCAAAGGAGGG - UNI2740 - ACCGCTGACAAAGGAGCCTCAACCAGCCAGGAAAAAGGCTAACTCCATCTGCCCCTAC

CTACCCCTACATGGCTTGAGGGTCCTTGTCTGGAGTGGGCAACTGGGCCCAGACTCTGGAAAGCCAGGCCCAGGGCCTGTGCTGATCCCCAGGGAGTGCA

TGCCTGGCGTTCCAGGTGCACATGGAGGAGAGAGACTGGAGGGAGCCCTTCACCTGGCCCACCCCTCACTGCACTGGCTGCTTCAGAGGGTCGGGAGGAC

AGGCTCCTAGCCTGCCTAGGAGACCCCATCCTCCGCAGATGCCTAGGGGCCCCCAAAGAGCAAAGTAGGTCTCAGCATGAGAGATGGAGGGTTGGTTGGA

CCTACCACATAAACCAATCAGCACTTGAATGGGGAAGGTGGAAGAAGGGTGGACCCCCAGGCCTATCCCTGTGTGGAAATTTCTTACGGAGAAAGGGCTG

GGCCCACCTGACCTTCCGTTTCTTCCCAGCAGAAGGGATCCATCCCTTTGACTGTTTCTTATCATCCCTTCCCACTGAGGGTCACAAGCTGAGCTTGGAA

AAGCCTACAGATGTGGGGGGCTGAGGAAGGGCAGGACAGCACTTCTTGGGGCCCCATGATGGGGCTGGCTGGGGACGTCCCGTGCTGACCTGGGTGCCCT

GCCCCTTTTTGCACTATTGGCTTGAGGAGTGCCGAGGGTGGGGAGAGGGGGCTGCCTGACTCCACAGATTGTGAGTGTGTGAGTGTGTGTGTGAGTGAGA

GAAAAAGAGAGAGATGGTTAGTCTGTTTAACCTGTCTGTCTATCTGTCATTTCTTCCTCTGGACCTGGGGCAGCCAAGGGCAAGGACAGGAGCAGTGGCC

AGTACTGGGGCAGTGGCCAGTACCGGGGCAGTGGCCAGTACCAGGGCAGGAGCTCCTAGCTCTTGCATCCTCTACCCCCTCACCAACTCTGCTCCTTTTC

CAGGGCATGAATGGTTAACTTATAAAAAACATAAAACAAACAACAGACCAGTACCTCCAGTATTGGAGAATTCCTAGGGGCTGGGGGCTCTGAATCAGGG

TAATACCCTACCTTCCCTCCCCTCTACCCCACCTCAGGGCCCCTCAGGGCCTCCTCCCCCACTGTTAGTTTGATCAGTCCTGGCACAAGAGAGTAGGGGA

GGGGTAAAGTGCCACTTCTTTTTAGCAAAAGTCTCCCTCTCCGAAGTAGCTAGCCTGCCTCTTGAATCCTTTCACCAGCTAGTAGAGCCACTTAAGCTAA

CAACCACCCCTTACCCCACCAGCTATTTTCCAGGGTGTAGTAATAAGTGGCAGAGACTTTCTGCCCAGGGCGGTAATGAAAAACGTTGAGTGGGACACGG

AGCACCGCCAAGGAGGCCTTGTGTCCCTTTTGGTTGCACTGGCTGGGACTGAGGGTCAGTTCCAGTTTCCCTTGCTCATGTCTGTGGGTCTCTGCATGTG

TGCATTTTGGTGTGTTTACGTTTGAGTTTTGTTGTTGGGGGTTTTTTTTGTTGTTGTTGTTTTTTTTTTTTTTTGCTTGTTTGTTTTGGTTTTTTTTTTT

TTTTAATAAAGAAAAGGTGTATATTTTTGGCAAGGACAGAAACGTAGTACAGATATATTTTTGCCTGTGCTGCTCAACTGTTGTCCCTCACTCCCACCCC

CCATGATCTGGGAAATACTATTCCTGTTGATAAGACAGGAATAAGATAGGATAAGATAGGATGGGCCGGGACCCTTCAGAGGCAACCCTTTGACACTTGG

AAGGACTTTGGGGGACAGTTGAGATGACCTCAGAAATACTTTTCTAACTGCTATTACTAGAAAGACATCTTCATCTCTTCCGCTCTTGTAGACCTCCTTG

TCTACGAGCCAGTGATTCTTCAGATTCGTCTACGACCTTTTTATCCAGGCCCACACCCTTGCCCCACGCAGAGCCAAGTACCCTGCATTGTGGCGCAGGG

GTGCTCGGGGCTCTGGAACTCTGTTCTCAGCAGTTCCCTGGGCTCCTTTCCCTGTTCTGGGCCAGGCAGGATGCCCTAACAGAGTCAGGTCAGGCTTGCA

GAGGCCTCTGGGCTGGATGGTTTGGTGTTGGCTCCTCTTTTTTGGGGGTGGGGTGGGGTGGGGAGGCGTTTTTCGAGACAGGGTTTTCTCTGTGTAGCCC

TGGCTGACTTAGAACTGGCTGTGTAGACCAGGCTGGCCTCAGACTCAGATCTGCCTGCCTCTGCCTCCAGAGTGCTGGGATTAGAGGCGAGCTGGTGGTG

CTATTCCATATCCTGAGACATGAGGAGAGGTGTGGCCTGGTGCCGCAGCACAGGGAGAATTAGGGTCCTTGGGAGGGACCAGGGTTCTGCAAAATGGCTC

TGATGACCTCACCTTTTTTTTTTTTAAAGACAAGGTCCCAAGTGCTGGGGTTAAAGGCGTGCGCTACCACGCCCGGCACAAGGTCTACTCTTAATGTAGC

TTTGGTCGTCCTGGAACTTGCTATGTAGACCAGGCTGGCCTCAGCCTCCTGAGTGCTGGGATTAAAGGTGTGTGCCACTATGTCTGGCTTTGGTCCATTT

TTTTTGATAAAGAGCTTGGTAGAAGGAGAGAAAGGATGCAGATTTGGGGCCATCTCTATCTGGGAGGGGGAGGATGTGGTTTGCAGAGCGGAAGTGGAGT

CTCAGAATGCATGAGTGGATCTTAATGTCACCACCCTAAGTGAGAAGAGGTGAGCGGGTGACAGATGCTGAGCCTGTGCCCACCAGGGCAGGGGTGGCTG

GGTCATGGCTGATGGATGCTGATCAGGGGGTCATTGGAGCTGGCTTTACAGGCTACTGCTCTAAACCTAGGAGTGACGTGACCTCAGCAACAGCAGTGAC

AAGCCTTTGTACCTGGCCTTCTGGTCATAACTGCCTGACTGTCAAGCCTTTTAGCTGCAGCTGGTTGGCTGGCTGTCCCTGTGTGTGTGGTGAGTGTGGT

GGTGTGAGTGTAGTAGGGTTGTGCCCGTGGCGGGAAGGTATCTATGTAGCACTGACTGTCTTAGCTCTGAGCTGACGAATCCTCCACAGACAATGACACT

TTAAGGGTTGCCTTTAAGAGAAGAAATAAATTGTATGTCCCATCCCCCTCTCCCTCATCCCCCAGCTTGTGGGTGTCCCTCTCAAGCTCCTGGGTCTACT

GCTGGTGATCCCTTCCCTTCCTTGTGTGAAGACCCAGGGAGTTCCCACCCTAGACTCCTAGGAAGGGCCTAGACAAATGAGAGCCCAAAGAGGCTACCAG

TTCCATTTCCTCTTCCCACCCTGGAAATGCTGACCTGTTTTCAGAGACACAGGCCCGCCCTGCTAGTCTCAGTCATCCCAAGAGTGCAGAGGGCCAAAGG

GAGTAACAGACTGCTGGTGCCTGGGGAGAGGTGCCCACTAGGACAGAGGGAGGTGGGGCCAGGGAGAGGTGCCCGCTAGGACGGAGGGAGGTGGGGTCAG

GGAGTCCCTCTGTTCCCTCCAGCCGCTTCCTCCTGGATTACAGGTGTGTCTAGTTCCCAGCAGACCACCTTGTCTTGACCTACTGAAGCGTTGGGGACTG

AGGACCGTCCTCTTTCTCCTGTGTTCACTTTCTCCAGCCCCACTTGGGACTGAAGACCCGAAGGACTGTGGCTCCCTTCCTTCCATCCCAGCCTGTTTCC

ATGTAGCAGACCCTTCCTAAGGGAGCAAGGAAGGGAAGCCACAGATTGCAAACCCAGGGGCTCATTTTTCATTCTTTCTGAAACCTTTATATCCTCAGCC

CAAGAGACGGTGTTCCCCTGCGACCTCCAAGCCTGGAATTGTGCATAGCCTGGGTCTTGTATCTTTGTATAACGGATGTTATTTGTACGAAGGGCAGTTC

GTAAACAGCACTTGTTCTTTTAATAAAAGAATGTTTTACT
Translation
MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQA - UNI26978 - ACYGIVQVPTGPWFCRKCESQERAARV - UNI5556 - RCELCPHKD

GALKRTDNGG - UNI23228 - GWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNK - UNI26771 - TCYICEEQGRESKAASGACMTCNRH

GCRQAFHVTC CAQMAGLLCEEEVLEVDNVKYCGYCKYHFSKM - UNI24064 - KTSRHSSGGGGGAGGGSSGGGGGGSSSASGGGGGTGGGSGNSF

LSGRRSRSASPSTQPEKHPTHHEKGQKK - UNI4878 - SRKDKERLKQKHKKRPESPPSVLAPPAVPTADK - UNI7105 - - UNI8429 - V

SSATSSSHHEASTQETSESSRDSKGRKSSSHSLSHKDKKLGTGKGVSSFTSASSSSSSSSSSSSSSSGGPFQPAG - UNI14934 - GSSLQSSPDFA

AFPKLEQPEEDKYPKPADPTPPAPPSPTAPEPPKADLFEQKVVFSGFGPIMRFTTTASSSSRARAPSPGDYKSPHITGAGASAGTHKRMPALSATLGPAE

EAPETTLKEKKHKASKRSRHGPGRPKGSRGKEGASGPTASLPAAQLAGFTATAASPFSGGSLVSAGLGGLASRTFGPSGSLPSLSLESSLLGAG - UNI

8473 - GIYTSNKDPISHGGGMLRAVCSTPLSSSLLGPTGTSALPRLSRSPFTSTLASSSASISTTQ - UNI8168 - VFSLAGSTFSLPSSHIFGT

PMGTVNPLLTQAESSHTE - UNI12589 - EPDLEDCSFRCHGTSPQESLSSM MSPISSLPALFDQTSAPCAGGQLDSTAPGTTNMEQLLEKQGDGE

AGVNI - UNI36403 - IVEMLKALHALQKENQRLQEQILSLTAKKERLQVLNVQLSVPFPALPAALPATNGPIPGPYGLLPQA AGSSDSLSVSKSP

PGKNSLGLDNSLSTSSE DPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGATGLGAMPMAEGLLGGLAGSGSLPL

NGLLGGLNGAAAPNPAGLSQAGGAPTLQLPGCLNS SLTEQQRHLLQQQEQQLQQLQQLLASPQLTP EHQTVVYQMIQQMQQKRELQRLQMAGGSQLPM

ASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGSNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLPGADASGNGPKGG - UNI2740 - 

TADKGASTSQEKG
Transcript ENSMUST00000044730
Sequence
CCGAGGAGGAGGAAGGAGGAGGCAAAGAAAAGAAGCGGCGGCGGCGGCGGCGGAGGAGGGGGCGAGGAGGCGCGCGGCCCCCGCTCCCTCCCTCCCCCCC

TGACCCCCGACCCCCGCCGGCCGGCCCCCAGCCCCAGCCCCGGAGGGAGCTCATGGGAGTATGAAGGAGATGGTAGGAGGCTGCTGCGTATGTTCGGACG

AGAGGGGCTGGGCCGAAAACCCGCTGGTCTACTGCGATGGGCACGCGTGCAGCGTGGCCGTCCACCAAG - UNI26978 - CTTGCTATGGCATCGTC

CAGGTGCCAACAGGACCCTGGTTCTGCAGGAAATGTGAATCTCAGGAGCGTGCAGCCAGGGTG - UNI5556 - AGGTGTGAGCTGTGCCCGCACAAA

GATGGGGCATTGAAGAGGACTGACAATGGAG - UNI23228 - GCTGGGCCCATGTGGTGTGCGCCCTCTACATCCCGGAGGTGCAGTTCGCCAACGT

GCTCACGATGGAGCCCATCGTTCTGCAGTACGTGCCTCATGATCGCTTCAACAAG - UNI26771 - ACCTGTTACATCTGTGAGGAACAGGGCCGGG

AGAGCAAAGCTGCCTCGGGAGCCTGCATGACCTGTAACCGCCACGGATGCCGACAAGCTTTCCATGTCACCTG TGCCCAGATGGCTGGCCTGCTGTGTG

AGGAAGAAGTCCTGGAGGTGGACAACGTCAAGTACTGCGGCTACTGCAAATACCACTTCAGCAAGATG - UNI24064 - AAGACATCCCGGCACTCC

AGCGGGGGAGGAGGAGGAGCAGGAGGAGGCAGCAGCGGCGGGGGAGGAGGTGGCAGCAGTAGTGCCAGCGGTGGTGGAGGTGGCACCGGGGGAGGCAGCG

GCAACAGCTTCCTTAGCGGCAGGAGAAGCCGGTCAGCCTCGCCATCCACCCAGCCGGAGAAGCACCCTACCCACCATGAGAAGGGCCAGAAGAAG - UN

I4878 - AGTCGAAAGGACAAAGAACGCCTTAAACAGAAGCACAAGAAGCGGCCTGAGTCCCCCCCCAGCGTCCTCGCCCCGCCTGCGGTTCCCACTGC

TGATAAG - UNI7105 - - UNI8429 - GTCTCCTCAGCGACTTCTTCCTCCCACCATGAGGCCAGCACTCAGGAGACCTCTGAGAGTAGCAGGGA

CTCAAAGGGGAGAAAGTCTTCCAGCCATAGCCTGAGTCATAAGGACAAGAAACTGGGCACTGGGAAAG - UNI7105 - - UNI14934 - GCTCGT

CTCTGCAGAGCTCTCCTGACTTTGCAGCGTTCCCCAAGCTGGAACAGCCGGAGGAAGACAAATATCCCAAGCCTGCGGACCCCACCCCGCCGGCCCCTCC

CTCGCCCACGGCCCCTGAGCCCCCAAAGGCTGACCTCTTTGAACAGAAAGTTGTCTTCTCTGGCTTTGGGCCCATCATGCGCTTCACCACCACCGCCTCC

AGCTCCAGCCGGGCCCGAGCCCCTTCACCTGGAGACTATAAGTCTCCCCATATTACCGGGGCCGGGGCCTCAGCAGGCACCCACAAACGGATGCCCGCAC

TGAGTGCCACCCTTGGACCTGCTGAGGAGGCCCCTGAGACCACCCTGAAGGAGAAGAAACACAAAGCCAGCAAAAGGAGCCGACACGGGCCAGGCCGACC

CAAAGGGAGCAGAGGCAAGGAGGGTGCTTCAGGCCCGACTGCCTCCCTCCCTGCGGCTCAGCTCGCTGGCTTCACTGCCACTGCGGCCTCACCCTTCTCT

GGGGGCTCCCTGGTCAGCGCTGGCCTGGGGGGTCTGGCCTCCCGTACCTTTGGGCCTTCAGGAAGCTTGCCCAGCTTGAGCTTAGAGTCATCTCTGCTGG

GGGCAG - UNI8473 - GCATCTATACCAGTAATAAGGATCCCATCTCTCATGGTGGAGGGATGCTGCGGGCTGTCTGCAGCACCCCACTCTCTTCCA

GCCTGCTGGGGCCCACAGGAACCTCAGCCTTGCCGCGCCTCAGCCGGTCCCCCTTCACCAGCACCCTTGCATCCTCTTCTGCTTCCATCTCCACCACTCA

G - UNI8168 - GTGTTTTCTCTGGCTGGCTCAACCTTCAGCCTCCCTTCATCCCACATCTTTGGAACCCCCATGGGCACTGTTAACCCCCTCCTCAC

CCAAGCGGAGAGCAGCCACACAG - UNI12589 - AGCCAGACCTAGAAGACTGCAGCTTCCGGTGTCACGGGACCTCCCCCCAGGAGAGTCTCTCTT

CCAT GTCTCCCATCAGCAGCCTCCCTGCGCTCTTCGACCAGACGTCGGCGCCCTGTGCGGGTGGCCAGTTAGACTCCACAGCCCCCGGGACAACCAACA

TGGAGCAGCTGCTGGAGAAGCAGGGTGACGGAGAGGCTGGTGTCAACA - UNI36403 - TTGTGGAGATGCTGAAGGCCCTGCATGCGCTGCAGAAG

GAAAACCAGCGGCTGCAGGAGCAGATCCTTAGCCTGACAGCGAAGAAGGAGCGGCTCCAAGTCCTCAACGTGCAGCTCTCCGTTCCCTTCCCCGCCCTGC

CTGCTGCCCTGCCGGCCACTAACGGCCCCATCCCAGGGCCCTATGGACTGCTTCCTCAAG CTGGCAGCAGTGACTCCCTGAGCGTCAGCAAGAGCCCTC

CCGGGAAGAACAGCCTCGGCCTGGACAATTCCCTGTCCACCTCTTCCGAG GACCCACACTCAGGCTGCCCGAGCCGCAGCAGCTCTTCGCTCTCCTTCC

ACAGCACGCCCCCACCGCTGCCCCTGCTCCAGCAGAGCCCGGCTACTCTGCCCTTGGCCCTGCCTGGGGCTCCTGCCCCACTCCCACCCCAGCCACAGAA

CGGGCTGGGCCGGGCGCCTGGAGCAACGGGGCTGGGAGCCATGCCCATGGCTGAGGGGCTGTTGGGTGGGCTGGCAGGCAGCGGGAGCCTGCCCCTCAAT

GGGCTTCTGGGAGGGTTGAATGGGGCTGCTGCTCCCAACCCCGCGGGCTTGAGCCAGGCTGGCGGGGCCCCCACGCTTCAACTGCCAGGTTGTCTCAACA

G CCTGACAGAGCAGCAGAGACACCTCCTTCAGCAGCAAGAGCAGCAGCTGCAGCAACTGCAGCAGCTCCTGGCCTCTCCACAGCTGACCCCA GAGCAC

CAGACTGTGGTCTACCAGATGATCCAGCAGATGCAGCAGAAACGGGAGCTGCAGCGGCTACAGATGGCTGGGGGCTCTCAGCTGCCCATGGCCAGTCTAC

TGGCTGGAAGCTCCACCCCACTGCTGTCCGCGGGCACCCCTGGCCTGCTGCCCACAGCATCAGCCCCACCCCTGCTGCCTGCTGGAGCCCTGGTGGCCCC

TTCACTGGGCAGCAATACAAGTCTAATGGCTGCAGCGGCTGCAGCCGCAGCGGTGGCGGCGGCAGGCGGACCTCCAGTCCTCACTGCTCAGACCAACCCT

TTTCTCAGCCTGCCTGGGGCAGACGCCAGTGGGAATGGCCCCAAAGGAGGG - UNI2740 - ACCGCTGACAAAGGAGCCTCAACCAGCCAGGAAAAA

GGCTAACTCCATCTGCCCCTACCTACCCCTACATGGCTTGAGGGTCCTTGTCTGGAGTGGGCAACTGGGCCCAGACTCTGGAAAGCCAGGCCCAGGGCCT

GTGCTGATCCCCAGGGAGTGCATGCCTGGCGTTCCAGGTGCACATGGAGGAGAGAGACTGGAGGGAGCCCTTCACCTGGCCCACCCCTCACTGCACTGGC

TGCTTCAGAGGGTCGGGAGGACAGGCTCCTAGCCTGCCTAGGAGACCCCATCCTCCGCAGATGCCTAGGGGCCCCCAAAGAGCAAAGTAGGTCTCAGCAT

GAGAGATGGAGGGTTGGTTGGACCTACCACATAAACCAATCAGCACTTGAATGGGGAAGGTGGAAGAAGGGTGGACCCCCAGGCCTATCCCTGTGTGGAA

ATTTCTTACGGAGAAAGGGCTGGGCCCACCTGACCTTCCGTTTCTTCCCAGCAGAAGGGATCCATCCCTTTGACTGTTTCTTATCATCCCTTCCCACTGA

GGGTCACAAGCTGAGCTTGGAAAAGCCTACAGATGTGGGGGGCTGAGGAAGGGCAGGACAGCACTTCTTGGGGCCCCATGATGGGGCTGGCTGGGGACGT

CCCGTGCTGACCTGGGTGCCCTGCCCCTTTTTGCACTATTGGCTTGAGGAGTGCCGAGGGTGGGGAGAGGGGGCTGCCTGACTCCACAGATTGTGAGTGT

GTGAGTGTGTGTGTGAGTGAGAGAAAAAGAGAGAGATGGTTAGTCTGTTTAACCTGTCTGTCTATCTGTCATTTCTTCCTCTGGACCTGGGGCAGCCAAG

GGCAAGGACAGGAGCAGTGGCCAGTACTGGGGCAGTGGCCAGTACCGGGGCAGTGGCCAGTACCAGGGCAGGAGCTCCTAGCTCTTGCATCCTCTACCCC

CTCACCAACTCTGCTCCTTTTCCAGGGCATGAATGGTTAACTTATAAAAAACATAAAACAAACAACAGACCAGTACCTCCAGTATTGGAGAATTCCTAGG

GGCTGGGGGCTCTGAATCAGGGTAATACCCTACCTTCCCTCCCCTCTACCCCACCTCAGGGCCCCTCAGGGCCTCCTCCCCCACTGTTAGTTTGATCAGT

CCTGGCACAAGAGAGTAGGGGAGGGGTAAAGTGCCACTTCTTTTTAGCAAAAGTCTCCCTCTCCGAAGTAGCTAGCCTGCCTCTTGAATCCTTTCACCAG

CTAGTAGAGCCACTTAAGCTAACAACCACCCCTTACCCCACCAGCTATTTTCCAGGGTGTAGTAATAAGTGGCAGAGACTTTCTGCCCAGGGCGGTAATG

AAAAACGTTGAGTGGGACACGGAGCACCGCCAAGGAGGCCTTGTGTCCCTTTTGGTTGCACTGGCTGGGACTGAGGGTCAGTTCCAGTTTCCCTTGCTCA

TGTCTGTGGGTCTCTGCATGTGTGCATTTTGGTGTGTTTACGTTTGAGTTTTGTTGTTGGGGGTTTTTTTTGTTGTTGTTGTTTTTTTTTTTTTTTGCTT

GTTTGTTTTGGTTTTTTTTTTTTTTTAATAAAGAAAAGGTGTATATTTTTGGCAAGGACAGAAACGTAGTACAGATATATTTTTGCCTGTGCTGCTCAAC

TGTTGTCCCTCACTCCCACCCCCCATGATCTGGGAAATACTATTCCTGTTGATAAGACAGGAATAAGATAGGATAAGATAGGATGGGCCGGGACCCTTCA

GAGGCAACCCTTTGACACTTGGAAGGACTTTGGGGGACAGTTGAGATGACCTCAGAAATACTTTTCTAACTGCTATTACTAGAAAGACATCTTCATCTCT

TCCGCTCTTGTAGACCTCCTTGTCTACGAGCCAGTGATTCTTCAGATTCGTCTACGACCTTTTTATCCAGGCCCACACCCTTGCCCCACGCAGAGCCAAG

TACCCTGCATTGTGGCGCAGGGGTGCTCGGGGCTCTGGAACTCTGTTCTCAGCAGTTCCCTGGGCTCCTTTCCCTGTTCTGGGCCAGGCAGGATGCCCTA

ACAGAGTCAGGTCAGGCTTGCAGAGGCCTCTGGGCTGGATGGTTTGGTGTTGGCTCCTCTTTTTTGGGGGTGGGGTGGGGTGGGGAGGCGTTTTTCGAGA

CAGGGTTTTCTCTGTGTAGCCCTGGCTGACTTAGAACTGGCTGTGTAGACCAGGCTGGCCTCAGACTCAGATCTGCCTGCCTCTGCCTCCAGAGTGCTGG

GATTAGAGGCGAGCTGGTGGTGCTATTCCATATCCTGAGACATGAGGAGAGGTGTGGCCTGGTGCCGCAGCACAGGGAGAATTAGGGTCCTTGGGAGGGA

CCAGGGTTCTGCAAAATGGCTCTGATGACCTCACCTTTTTTTTTTTTAAAGACAAGGTCCCAAGTGCTGGGGTTAAAGGCGTGCGCTACCACGCCCGGCA

CAAGGTCTACTCTTAATGTAGCTTTGGTCGTCCTGGAACTTGCTATGTAGACCAGGCTGGCCTCAGCCTCCTGAGTGCTGGGATTAAAGGTGTGTGCCAC

TATGTCTGGCTTTGGTCCATTTTTTTTGATAAAGAGCTTGGTAGAAGGAGAGAAAGGATGCAGATTTGGGGCCATCTCTATCTGGGAGGGGGAGGATGTG

GTTTGCAGAGCGGAAGTGGAGTCTCAGAATGCATGAGTGGATCTTAATGTCACCACCCTAAGTGAGAAGAGGTGAGCGGGTGACAGATGCTGAGCCTGTG

CCCACCAGGGCAGGGGTGGCTGGGTCATGGCTGATGGATGCTGATCAGGGGGTCATTGGAGCTGGCTTTACAGGCTACTGCTCTAAACCTAGGAGTGACG

TGACCTCAGCAACAGCAGTGACAAGCCTTTGTACCTGGCCTTCTGGTCATAACTGCCTGACTGTCAAGCCTTTTAGCTGCAGCTGGTTGGCTGGCTGTCC

CTGTGTGTGTGGTGAGTGTGGTGGTGTGAGTGTAGTAGGGTTGTGCCCGTGGCGGGAAGGTATCTATGTAGCACTGACTGTCTTAGCTCTGAGCTGACGA

ATCCTCCACAGACAATGACACTTTAAGGGTTGCCTTTAAGAGAAGAAATAAATTGTATGTCCCATCCCCCTCTCCCTCATCCCCCAGCTTGTGGGTGTCC

CTCTCAAGCTCCTGGGTCTACTGCTGGTGATCCCTTCCCTTCCTTGTGTGAAGACCCAGGGAGTTCCCACCCTAGACTCCTAGGAAGGGCCTAGACAAAT

GAGAGCCCAAAGAGGCTACCAGTTCCATTTCCTCTTCCCACCCTGGAAATGCTGACCTGTTTTCAGAGACACAGGCCCGCCCTGCTAGTCTCAGTCATCC

CAAGAGTGCAGAGGGCCAAAGGGAGTAACAGACTGCTGGTGCCTGGGGAGAGGTGCCCACTAGGACAGAGGGAGGTGGGGCCAGGGAGAGGTGCCCGCTA

GGACGGAGGGAGGTGGGGTCAGGGAGTCCCTCTGTTCCCTCCAGCCGCTTCCTCCTGGATTACAGGTGTGTCTAGTTCCCAGCAGACCACCTTGTCTTGA

CCTACTGAAGCGTTGGGGACTGAGGACCGTCCTCTTTCTCCTGTGTTCACTTTCTCCAGCCCCACTTGGGACTGAAGACCCGAAGGACTGTGGCTCCCTT

CCTTCCATCCCAGCCTGTTTCCATGTAGCAGACCCTTCCTAAGGGAGCAAGGAAGGGAAGCCACAGATTGCAAACCCAGGGGCTCATTTTTCATTCTTTC

TGAAACCTTTATATCCTCAGCCCAAGAGACGGTGTTCCCCTGCGACCTCCAAGCCTGGAATTGTGCATAGCCTGGGTCTTGTATCTTTGTATAACGGATG

TTATTTGTACGAAGGGCAGTTCGTAAACAGCACTTGTTCTTTTAATAAAAGAATGTTTTACT
Translation
MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQA - UNI26978 - ACYGIVQVPTGPWFCRKCESQERAARV - UNI5556 - RCELCPHKD

GALKRTDNGG - UNI23228 - GWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNK - UNI26771 - TCYICEEQGRESKAASGACMTCNRH

GCRQAFHVTC CAQMAGLLCEEEVLEVDNVKYCGYCKYHFSKM - UNI24064 - KTSRHSSGGGGGAGGGSSGGGGGGSSSASGGGGGTGGGSGNSF

LSGRRSRSASPSTQPEKHPTHHEKGQKK - UNI4878 - SRKDKERLKQKHKKRPESPPSVLAPPAVPTADK - UNI7105 - - UNI8429 - V

SSATSSSHHEASTQETSESSRDSKGRKSSSHSLSHKDKKLGTGKG - UNI7105 - - UNI14934 - GSSLQSSPDFAAFPKLEQPEEDKYPKPAD

PTPPAPPSPTAPEPPKADLFEQKVVFSGFGPIMRFTTTASSSSRARAPSPGDYKSPHITGAGASAGTHKRMPALSATLGPAEEAPETTLKEKKHKASKRS

RHGPGRPKGSRGKEGASGPTASLPAAQLAGFTATAASPFSGGSLVSAGLGGLASRTFGPSGSLPSLSLESSLLGAG - UNI8473 - GIYTSNKDPIS

HGGGMLRAVCSTPLSSSLLGPTGTSALPRLSRSPFTSTLASSSASISTTQ - UNI8168 - VFSLAGSTFSLPSSHIFGTPMGTVNPLLTQAESSHTE

 - UNI12589 - EPDLEDCSFRCHGTSPQESLSSM MSPISSLPALFDQTSAPCAGGQLDSTAPGTTNMEQLLEKQGDGEAGVNI - UNI36403 -

 IVEMLKALHALQKENQRLQEQILSLTAKKERLQVLNVQLSVPFPALPAALPATNGPIPGPYGLLPQA AGSSDSLSVSKSPPGKNSLGLDNSLSTSSE 

DPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGATGLGAMPMAEGLLGGLAGSGSLPLNGLLGGLNGAAAPNPAGL

SQAGGAPTLQLPGCLNS SLTEQQRHLLQQQEQQLQQLQQLLASPQLTP EHQTVVYQMIQQMQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPG

LLPTASAPPLLPAGALVAPSLGSNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLPGADASGNGPKGG - UNI2740 - TADKGASTSQEKG

For any suggestions or comments, please send an email to unitrap@crg.es