Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038446 (Cdc40)
Chromosomal location
Chr 10: 40551432 - 40602915 (-)
Description
cell division cycle 40 homolog (yeast) Gene [Source:MGI Symbol;Acc:MGI:1918963]
RefSeq_peptide
NP_082155.1 
UniGene
Mm.46063 
MGI
MGI:1918963 
Uniprot/SWISSPROT
Q9DC48 
Uniprot/SPTREMBL
B2RY33 Q3UXN9 Q6P8J8 
Human Ortholog
ENSG00000168438 (CDC40)
Omim not available
UniTrap UNI19951
Vector Insertion
Chr 10: 40587717 - 40602692
Public Clones (sanger) IST14884H10 (tigm)
Private Clones OST376586 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2671
Vector Insertion
Chr 10: 40577483 - 40587629
Public Clones XR1157 (sanger) AL0544 (sanger) IST10164A7 (tigm) IST10164H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10064
Vector Insertion
Chr 10: 40569648 - 40570735
Public Clones XC614 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12201
Vector Insertion
Chr 10: 40556171 - 40561159
Public Clones W204A01 (ggtc)
Private Clones OST60552 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20514
Vector Insertion
Chr 10: 40554127 - 40556093
Public Clones not available
Private Clones OST360149 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27255
Vector Insertion
Chr 10: 40553163 - 40553981
Public Clones not available
Private Clones OST65578 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044166
Sequence
GGCCTGGCCTTAGCAGAGAGTATCTGTTGCAGTCATGTCGGCTGCGATTGCAGCTCTAGCTGCTTCGTATGGCTCGGGCTCGGGGTCCGAATCGGATTCG

GACAGTGAGGGCAGTCGGTGTCCGCTGCCAGCCGCGGACTCTCTCATGCACTTGACCAAATCGCCTTCAGCCAAGCTCTCTCTGACCGTGGCGGTGGACT

CGGCTCCGGAGGTGGCAGTTAAG - UNI19951 - GAAGATCTGGAGACTGGAGTTCACCTTGACCCTGCTGTCAAAGAAGTTCAGTATAATCCCACC

TATGAGACCATGTTCGCTCCTGAG - UNI2671 - TTTGGACCAGAAAATCCCTTTCGAACACAGCAAATGGCTGCCCCTAGAAATATGCTTTCTGGG

TATGCAGAGCCAGCACACATCAATGACTTCATGTTTGAACAGCAAAGAAGGACATTTGCTACGTACG GCTATGCACTGGACCCTTCGTTAGATAATCAT

CAGGTGTCTGCTAAGTATATTGGCTCTGTGGAAGAAGCGGAGAAGAACCAAG GCTTAACTGTATTTGAAACTGGTCAGAAGAAAACAGAAAAGAGGAAA

AAGTTCAAAGAAAATGATGCATCTAATATTGATGGTTTCTTGGGACCATGGGCAAAATATGTGGATGAAAAAGATGTGGCCAAACCTTCAGAA - UNI1

0064 - GAAGAACAAAAGGAATTGGATGAAATCACAGCAAAGAGGCAGAAAAAAGGCAAACAGGAAGAAGAGAAACCTGGGGAGGAGAAGACAATCTTA

CATG TTAAAGAAATGTATGACTATCAAGGCAGGTCCTACCTTCACATACCTCAGGATGTTGGTGTTAATCTACGGTCATCTGTGCCACCTGAAAAATGT

TACCTTCCCAAAAAACAAATTCACGTGTGGTCTGGACACACAAAG GGTGTCAGCGCCGTCAGGCTCTTTCCTCTTTCTGGACATTTGTTGCTGTCTTGC

TCCATGGACTGTAAAATTAAG CTATGGGAAGTTTATGGAGACCGGCGCTGTCTGAGAACATTTATTG GTCACAGTAAAGCTGTGAGAGACATCTGCTT

CAACACTGCAGGAACCCAGTTCCTCAGTGCGGCCTACGACAGGTACCTTAAACTCTGGGACACCGAGACAG GACAGTGTATATCAAGATTTACAAACCG

CAAAGTACCCTACTGCGTCAAGTTCAATCCCGATGAAGATAAGCAAAATCTCTTTGTGGCTGGGATGTCTGATAAGAAGATCGTACAG TGGGACATCCG

CAGTGGAGAGATTGTTCAGGAATATGATCGGCATCTGGGGGCTGTCAACACGATTGTTTTTGTTGATGAGAACCGAAGATTCGTGAGTACATCTGATGAT

AAAAGCCTACGAGTTTGGGAATG - UNI12201 - GGATATCCCTGTGGATTTTAAGTACATAGCAGAGCCCAGCATGCACTCAATGCCCGCAGTGAC

TTTGTCTCCAAATG - UNI20514 - GGAAATGGCTAGCATGCCAGTCAATGGACAACCAAATCTTAATTTTTGGAGCACAGAACAGATTCAGATTGA

ATAAGAAGAAAATATTTAAGGGCCACATGGTAGCAGGCTACGCTTGTCAGGTAGACTTCTCACCAGACATGAG - UNI27255 - CTATGTGATTTCA

GGAGATGGAAATGGGAAATTAAACATCTGGGACTGGAAGACCACAAAACTCTACAGTCGCTTTAAAGCCCATGATAAAGTGTGCATAGGCGCAGTGTGGC

ACCCCCATGAGACCTCCAAGGTCATCACGTGTGGTTGGGACGGCCTCATTAAGTTGTGGGATTAATGGGATTAGTCCTTTCACTGTCTGGGATCATTTTT

GATCCAGTGTCTTATTTAACTATTTAATTATTAAAATGTGTTGGATGACAGTTTGATTTATAGGTAATCTTTTCTTATATGGCCTTATGATGTTGGCCTA

TTGTTTTTAAGAGCTTGGTAAATTTGCCTCAGAGAAGTTCAATAGCAACTTCATTTTGTTCTTTATAGATGTTATTTATATGGGGAATGACAACTGGTTA

TATTTGACAAGTAGTTACTGTTGGCAGGCAGTTGCGTTTGTCCCTGTGATGTCACTGAAAGGATCAAAGGATCGTTTTGGAGTGAAGAAAAAAAAATGCC

TATTGGATATGGGATCTTATGGGAAATGATGTAGCTAACGACTCAGAAAGGTGCCAGGCACTTAACCGACCCACCCAGCAGGGTGGCAGGAATACAGGCG

GAGCCACCCACAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCCACAGTCACCCA

CAGTCACCTACAGTCACCTACAGTCACCTACAGTCACCCACAGTCACCCACAGTCGCCTACAGTCACCTACAGTCACCCACAGTCACCCATAGTCACCCA

CAGTCACCCACAGTCACCTACAGTCACCCACAGTCACCGCTGCTGAATCAAGCTCTTGTCTTCTTCCGGTTCCATTATTTTTATGGCCTTTGTATTTTTA

CGTGTAAACTAGTGACCCTCATTGGTTGCAGCTTTCTTCTAACTATTAAGCAATGTAAAATTAGAAAGCAGTCCGAAGTTCCTTTCTTGACTCTCTTCCT

AGTCACGAGAGACAGGACTGTGTAGACCTAAGCAGAAAGTGAGGTTGTCTCTGAAGCTGGAACTCAAGGGAACAAGCCAAGGCTTTGAATGTTGCTTGCA

ATCACTGTCTGTAAGGCCCTGGCTGCACCCAGAAATCAGGGTCTCAGGCTCTGCTTTGCCACTGGATGAATAATAATGAGTTCCCTCTGGCCAGAGTGTG

AAGACAGAGTCCAAAATACCACTTGTAATTTCTTTAAAGTCACAGTTTTGTCCTTAAAATCACTCTGGTTTTACTTGTGAATATAAACAGTAAAACTTTT

GAATGTTAGAAAAAAATTAAATTTCTTTTCAGATCTTTGAAAAACCATTGACATTATAAGAAAATGCCTGGAGCCCCCCAGTCTGAAAGGCCACGGGGCT

TTCTCTTTTTTAAATCACATGCTGAACATTGCACTGCCTAGCCATTGCCATTTCTGTGTCTTCCAGGAAGGGTGGCATATAGGAGGAAGGAATTATACAA

AACCATTCTGTCGTCCAAACCACTATTTTAACAAATGTGAATTACTGGAATGTAGTAAGAGAAAAACTTCAACAACAGTATTGCATGTTAACAAATCATA

ATTTCGTAATCTCAATTTCTTTTATTGTGTTTTTGACTGTTTCTAAACAGAGTAATTGTACATAAAAGTTTTCTCTTTTTTGAAAAGATCCTATTTTTGA

ATAAAGCATTCTTTTTAT
Translation
MSAAIAALAASYGSGSGSESDSDSEGSRCPLPAADSLMHLTKSPSAKLSLTVAVDSAPEVAVK - UNI19951 - EDLETGVHLDPAVKEVQYNPTYE

TMFAPE - UNI2671 - FGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYG GYALDPSLDNHQVSAKYIGSVEEAEKNQG GLTVFE

TGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSE - UNI10064 - EEQKELDEITAKRQKKGKQEEEKPGEEKTILHV VKEMYDYQGRS

YLHIPQDVGVNLRSSVPPEKCYLPKKQIHVWSGHTK GVSAVRLFPLSGHLLLSCSMDCKIK LWEVYGDRRCLRTFIG GHSKAVRDICFNTAGTQFLS

AAYDRYLKLWDTETG GQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQ WDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWE

W - UNI12201 - WDIPVDFKYIAEPSMHSMPAVTLSPNG - UNI20514 - GKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDF

SPDMS - UNI27255 - SYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

For any suggestions or comments, please send an email to unitrap@crg.es