Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038485 (Socs7)
Chromosomal location
Chr 11: 97223865 - 97259856 (+)
Description
suppressor of cytokine signaling 4 Gene [Source:MGI (curated);Acc:Socs7-001]
RefSeq_dna
NM_138657 
RefSeq_peptide
NP_619598.1 
UniGene
Mm.34339 Mm.398111 
MGI
MGI:2651588 
Uniprot/SWISSPROT
Q8VHQ2 
Uniprot/SPTREMBL
B1AQY1 
Human Ortholog
ENSG00000174111 (SOCS7)
Omim not available
UniTrap UNI112
Vector Insertion
Chr 11: 97237856 - 97238310
Public Clones GC0041 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19326
Vector Insertion
Chr 11: 97244343 - 97250425
Public Clones not available
Private Clones OST395208 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30424
Vector Insertion
Chr 11: 97251031 - 97254702
Public Clones CMHD-GT_384E10-3 (cmhd) CMHD-GT_532D3-3 (cmhd) IST14827G9 (tigm) IST14095F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045540
Sequence
GCCGCCGCCCCCGGGCCACAGCCATGGCCCGTCGCCGCCACCACCCTTCCTCGCGCGGCCCGGCTCGCGGGGCGCCCGGCCGCCTCAGCTGATGGTGTTC

CGCAACGTGGGGCGGCCGCCGGAGGAGGAGGACGCGGAGGCGGCCCGGGAGCCGGGACCCTCGGAACTGCTGTGTCCCCGGCACCGCTGCGCGCTGGATC

CCAAGGCCCTCCCGCCGGGCTTGGCGCTCGAGCGGACCTGGGGTCCCGTGGCTGGACTAGAGGCGCAGCTGGCGGCCCTGGGGCTCGGACAGCCGGCGGG

GCCGGGGATCAAGACTGCCGGCGGAGGCTGCTGTCCGTGCCCGTGTCCCCCGCAGCCGCCGCCGCCGCAACCCCCGCCGCCTGCTGCCGCCCCGCAGGCC

GGGGAGGACCCGACGGAGACGAGCGACGCGCTGCTGGTCCTGGAGGGCTTGGAATCGGAGGCCGAGAGCCTGGAGACTAACAGCTGCTCGGAAGAGGAGC

TCAGCAGCCCCGGCCGTGGAGGAGGAGGAGTGGGTGGCCGGCTGCTTCTGCAGCCTCCGGGTCCCGAACTACCCCCGGTGCCCTTTCCGCTGCAGGACTT

GGTCCCTCCAGGGCGCTTGAGCCGAGGGGAGCAGCAGCAGCAGCAACCTCCCCCACCGCCGCCGCCTCCCGGGCCCCTCCGGCCTCTCGCAGGCCCTTCT

CGGAAGGGCTCCTTCAAAATCCGCCTCAGTCGCCTGTTTCGCACGAAGAGCTGTAACGGCGGCTCGGGCGGCGGGGATGGGACCGGCAAGAGGCCTTCGG

GAGATCTGGCAGCTTCAGCTGCGAGCCTGACCGACATGGGAGGCTCAGCGGTCCGGGAGCTGGATACGGGGAG GAAACCCAGGTTGACAAGAACTCAAA

GTGCCTTTTCCCCGGTCTCCTTCAGCCCCCTGTTCACAG GTGAGACAGTATCGCTTGTGGACGTGGACATTTCTCAGCGGGGCCTGACCTCTCCACACC

CTCCAACTCCCCCTCCTCCTCCAAGAAGAAGCCTCAGCCTCCTAG - UNI112 - ATGATATCAGTGGGACGCTGCCTACATCTGTCCTTGTGGCTCC

GATGGGGTCTTCCTTGCAGTCTTTCCCCCTACCTCCGCCTCCTCCACCCCACGCCCCAG ATGCGTTTCCCCGAATTGCTCCCATCAGAGCGTCAGAATC

CCTGCACAGCCAGCCCCCTCAGCACCTCCAGTGTCCCCTCTATCGGCCCGACTCAAGCAGCTTTGCAGCCAGCCTTCGAGAGCTGGAAAAG TGCGGCTG

GTACTGGGGACCTATGAATTGGGAAGATGCAGAGATGAAACTGAAGGGGAAGCCAGATGGTTCTTTCCTGGTACGAGACAGCTCTGATCCTCGTTACATC

CTGAGCCTCAGCTTTCGATCACAGGGTATCACCCATCACACTAGAATGGAGCACTATAGAG GGACTTTCAGCTTATGGTGCCATCCCAAGTTTGAGGAT

CGCTGTCAGTCGGTGGTGGAGTTCATTAAGAGAGCCATCATGCACTCCAAGAACGGGAAATTTCTCTATTTCCTGAGATCCAGGGTCCCAG - UNI193

26 - GACTGCCACCAACTCCAGTACAGCTGCTCTATCCAGTGTCCAGATTCAGCAATGTCAAGTCCCTCCAGCATCTTTGCAGATTCCGGATCCGGCAG

CTTGTCCGAATAGACCATATTCCGGATCTGCCACTGCCTAA ACCTCTGATCTCTTACATTCGAAAGTTCTACTACTATGATCCTCAGGAAGAGGTGTAC

CTGTCCCTAAAGGAAGCGCAGCTCATTTCCAAACAGAAACAAGAGGTGGAGCCTTCCACGTAGCAGCAAGGACCCCTGCTGTTGAACATGAAG - UNI3

0424 - GCATTTGATCGCCAGGCTCCAGCTTGAAGAACCAAATGAGGCTACCACAAAAGAAGAATCTGGCAGAAAGAGAAGAGCGGGTTGTGATTCCTG

GCACAGACTTTGGTTCCCCTGTAGCCCTGGGGCTTGGAAGAAGCACACAACCATCCTCCAAGTGGGGCTCCCCACTCCCCAACCCATGAACCCCAGGGCC

AGATGAGCTCCTTGGAAAACTGGAAGAAGTCTTAACACTGTTTGTTTTCAGAAGTTAGCTTTTAGTATTTACATTTCTCGGTGGAAGGCAGCGGGGGTCT

ATACCCATTGAATTGAAGGTGGTGATGGGGATGAGCAGGTCAAGGGAAGGGTGGGGCGAGGAAGCCTGGTTGTTCAGCTGGTGCCAAAGGCAGCACTGAA

GTCTCTTCCGTGAACCTGGAGGGAGGGCGGGCGAGCCAGAGAGGTGCAAGAATGAGATGGGAGGTTTCTGGGAAAGGCATCTGATTCTCATCTCCTGCTC

CAACCGGCGAGGGAGGGGCGGGGAGAGAGGGTGGTGAGTGACAGAGGAACTGTTCGCTCATTCTGTTTGCTGGGGAAGAGCTCAATCCCACTCCTTCCCT

TTCAAGGTTTACAGACCTGATTGCAGAATCGCCTCTCATGGAATTGGTGTGCATTTTGTTGACTAAATTCCTTAAGCTCAGTGACCTGAGGCAAACCCAG

TTCTCCCTGCCCTCAGCCCCTTCCCCTCAGTAACTGTGGATTTCACTTTGGTCAAACCAACGCTCCTCTTGCTCTGCCAGCTGTGCAGGCAGTGGTGTGT

CCATCCCCGTTCCCCCCCCCCCCACCCGTGGGCAGTTCAGAGCTCCAATCCTGGGCTGCCAGGGCTTTACCCCAACTGTCAGCAACCCCATGCCTGGAGC

ATGCTTCCAGATTCTTTGTGGCAAAGCGTATCCACAGCTAAGGAGTCAGTGTTACCCCGCCCGCCCGCCTGTCAGCTAGTGAGCGGAAGTGTGGAGGAAG

TGAGAAACAGCTATCATGCTCCTAGAGGAGCCTGCGCGGCTCAGCCTTAACGGGATTTCTGTAGTGCAGAAAAGGCATGGCGTCTCATGGCCATAGGCTT

ATCAGTGTTGTCATCCCACCCCTGAGATGGAGGTGGCAAGGGCTTCTTCATTTCCCCATGTTCATTCTTGCAACCCGGACATTTCCTGAGTCAGACCCTG

TTGCCTTTCCTCACTGGGAACCTGTCAGATGCTAGTTTGCCTTTCAGATGGATGTGGAGGGAGGGAAGAACTTCGGTGCTTGAGTAGTCTTTGTGTCACA

TAAGTTTGCTGTCCTACAGAACTACTCAAGATGGACAGTGGGGTTGTTGGGTTCATTACTCTTAACCCTGTAGTATTTCATGTGATGGCCTTTTGAGTTC

CCCCTGCTTGTGTCTGCCTCAGGTGACAAAGTAAATATCGTCAGTCTTGGGTTTCCTGATGGTGGGGTGAAGCCCTGTGTCTAGGTAACTTAGAGAACTG

TCTTATCTGGAAAGTGGCCTGTGGGTTCCCTCTGTGCGTGGAGTCACCTTCCTCCTCCTTGAACTAAACACAGAGATGTGTTTTCTCAGCCGACTATAAA

GAACGGAGCCCCAAAAGGAACAGTTATGTGTCAGTCCATTTCACTGTTAACATAGCTCATGGTCATCCTAAGGTCAGGATTCAGAGACTGGCGTACCTGT

CAGCTCTGCCTCTGGAGGGTGCAGGCCACTTGCCATCTTGTAGAAAGGGCCGTGTGTAATGGAGTCCAACGTCCAGAGTCATAGAGGTCTTCACGGGATT

AATATTTGCAGTCCAGAGATCGTTTCTCCCATTTCAGCCACCCATGATATAAAAATTCCCTTTCAGCCGTGTTTGCATTGCTTGCATGGCTGTGAGCTAG

GTAGTGTGGACGGATGTGAGGTAGAAGACAAGACCCCTGCCCTGAGGGAACTGGAAAGTAACTGTTGCTCAGGAAGGAATTGGAACACTACTCAGTGTTG

CATAAAATCAAGGACCATCTTTAAAGATCGAGTGGGCATGATCAGGGTAGACCAGATGGTCTGGGAAAGCTCTGGTGATAAGGCTTGTAGGTGAGGGCGC

TGTGACAGAGACTCAAGCTAAAGTACAGAGCAGAAATGTGTGGCAAGGTCAACAGCATCAGAGTCCTACTGGACCGCAGTCTTTGGACAGGTCTGAAGGC

TAGGGAGAATGAGAGTGTGATGGAAGACAAAGCCAGCGTCAGCAGACACCTCTGGTCCTGGGGTCACCCATGGAGAATTTCTATACTCAGGTGCAAGCCA

GACCTGCTCCAGAGCATGGCAGCCTCACCCTTTCTGTCCTGGGAACTTGTGTTGTGCTGTTCTTAGGAGCTTCGGTGTTCCAGTCACAACTGGCCTGACC

CTTCCTCAGCAGGATGGGCCACAAAACAGCAGTGTGGGAGACAGCTCTAGGAGGAGGCATGGCCTGGCCCCAGGAGGCCTTGTTAGAAGGGAGTGAGCAG

TTGAGCCTGTTGACTGGGGAAGGGAGGGAGCGAGGCGAGAGGGCATGGATGGGTCTTCATCTTTCGCAGATGGTGGGGCAGTGCTAATGGAAGTGCAGTC

TGCAGGAGGAACTCAACTTGTCTTTGGTGGTTATGTGCCAGTCACAAACTGGGAAAGGCAGTCACTTTTAGAGACTAAAACTGCTGCAGTTTTCTAAGTT

GTGGTTGGGGGTGTCGCTACTCCTAGATGCAGCCTATGTAACCTTCACTCGTTTATAACTGATCTACTGTAACCTTCCTCAAACGGGTATGTTATTGTAA

GCTAGTGACAACTACTGCTGCAAGTTGTAGTTACTTGAAACGTGTGTCTGTGCTGGTAGTGCAGGCATGGGGGAACAGGAGCTTGGCTGTGGATCCACCT

GTCCTGACTTGATCGTGGTTGTGCACCAAGTGACATACATGTGCATAGAAAGGTTTGGAAGTGTCTCAGCTCCTGTCTCTCCTTGTCCCACTGTCACTTG

GACTAAGCCTCTGAGGCCAAGCAGGGTGTGGTGGGATGGCTACACATGCCCTGTGATGCATGTCCCCTGAGGACTAGGAAATGGTACAGCCCTAGAAGAG

CCCCAGGGAGCCACCCTTTCAGCCTTGCCTCATGTCTCTAGGAGGGCATGGCCTGCTTGAAGCTCCAATCCCATGGGAAGTAGGGACAGGAAAAGCTTCC

CTGGGTAGGAGCTTCCTTCCCTTCCTTGTTGCTTTTCTCTTACCTTTGAGCCCAGGAGTGAGAGGCCAAGTCGGCGAGATGGAAAGAGCCGTTCACAGGT

CTAGAGTTTTGCGTAAGCGAGCGAGAAAGCGCCCTCATTTGTCCAAGTCTTGTCTGCAGTTGGGGTGTTAGGAACATCTCCACTGGCGGGGACTAGGGTT

CGCTTTCCACTCTGATGAGAGAATGGCATGCCCACGTGTGGAGGGGATGAGCTCTGAGTTAGACATTTTCCCTATGGGAATCCTCTTGGTTTGGTTTGTG

GGGCGAGGGGAGTGGATATGTGGTTTTTATTTGTAGTCATCAACACAGCTGTCCTTACACTGAACCTGTGCTATTGCATACATGTAGCCATCTTTCTTTT

CACTGCAGCAGTGTTTATCGGTAGTTCAAAACGATTTATTTGCTCCTGGGGAGTAAAAACCTTTTTTATTAAAAAAGAAAAAAGAAAAAAAAAAAGAAAG

AAAGAAAAGAAAGAAAGGTGTGCCCCATTATGATAGCTGTAGAATTGTTGGGCCACAAGAGTCACGTCTGCAAGTCCCCTGTGGTCCATCTGTTTTGGCA

CTGGAGCCCTCGTGCTCAGTACAGTGTGACAGGGGCCCTTCCTTGGAAACGTGGAGAACATTTTGGGAGTGAGGTTGGGTTGAATCACTGAGAGGGCTCT

GGGGACAGAACTGCAGTTGAAAATAGAATACTGATTCTGTAATCTGCCAGAGAAAGGACCTTTCTTTACATACAGATTTCATGTGTCCTTGATCTTTCAT

TGCTTCCTGGTGTCCTGGATAGGGGTCACCTAGTTTCTTCTGGTGTCCCTCTTGTCTTTCCTGTCCTTTGTCCTGTCCCTTCCCACTTCATCTACCTCCC

AGAAAGCCCACCCTGCATGCTGTTTGTGACATGCTTTCACTCATCCCATCTTCAGAGGGTTTTAGAGGGTCCCTGGAGTCGCTCCCTGCCCCACTGACCC

CTCCTCATAGTGCCAAGAGGCAGCAAGGAGCAGACAAGCAGCCAGGCAGACAGCAACATTGAATCGCAGCTGGACTGTGACGGCAGCTGCTCCTGGAGAC

AGATAGGGAAAACAAGGCATTCTTCAGCCCACTTGCTGTGCTCTGTGGGCAGTGGGCTGATGCCACCACTCCTCCATCCCTGGTGCTCCCAAGAGGGACG

GGCAAGAGCCAGGCACCGCTCTGGGCAGGCCAGACATGAGGATGCCTGCACAGGTGCTGCACTGGTGCTGCATAGCACAGGCACTGACCGCTGTGCATTC

TGGTGGGTTTTCAGAAACTCCGTGCTGAGGGGTGTCATTCTGGACTCAGTGGTTGGAGTTTTTTTCACCACCGGGGAGCTGTACCCCCATAACCACTCTG

TCCTGCTTAGCCACCCCTGCCCTCCAAGCCAAAGCGTGGCCTGGCTTTTGTCTTCCCATTTAGTTTCCCTACTTTATTCTCCCTTTTTTGTGCTTAATTT

ATTAAAATAGTTGCTGTATAATTTATTTTCATAAAGTATAAAAAAATAACTAAATGGTTAAAATAGACTTGCAGGCCAATCTTAAATGGGGGTGGGTCTG

GGGTGGGATGGGGAGAGGGAAAGATGTTTTGATATAAACAAAACAAATGCACTTTGGGTGTGTTTTGGTATTTTTCTGGGCATAGAGGGGTGGGTGTTGG

GATGTCCCTGTAGATTAGTTCCAGAGTGGGGTGTCTGTAAATACTGTACTAATAGGCATGTGTGACTCTTGTAAAGGGACATTAGTAGCTGCTGCAGGTC

CTGTTTGGAAACTGTGTGTATAATTCCCGGTTTTTTGTAAGTGTCAGCGCGGGAGACATTTGACTCTTGTGTTTGTATCTCCTTTTTATGATTGCTGTAC

CGACCCATGTCTTTTTGGGGAGGGATGAAAAGAGATTTGAAATAAAAATGTTTAGAAATGA
Translation
MVFRNVGRPPEEEDAEAAREPGPSELLCPRHRCALDPKALPPGLALERTWGPVAGLEAQLAALGLGQPAGPGIKTAGGGCCPCPCPPQPPPPQPPPPAAA

PQAGEDPTETSDALLVLEGLESEAESLETNSCSEEELSSPGRGGGGVGGRLLLQPPGPELPPVPFPLQDLVPPGRLSRGEQQQQQPPPPPPPPGPLRPLA

GPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGDLAASAASLTDMGGSAVRELDTGR RKPRLTRTQSAFSPVSFSPLFTG GETVSLVDVDISQR

GLTSPHPPTPPPPPRRSLSLLD - UNI112 - DDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPD DAFPRIAPIRASESLHSQPPQHLQCPLYRP

DSSSFAASLRELEK CGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRG GTFSLWCHPKFEDRCQSVVEFIKRAIM

HSKNGKFLYFLRSRVPG - UNI19326 - GLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPK KPLISYIRKFYYYDPQEEVYLS

LKEAQLISKQKQEVEPST - UNI30424 - 

For any suggestions or comments, please send an email to unitrap@crg.es