Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038508 (Gdf15)
Chromosomal location
Chr 8: 73153293 - 73156355 (-)
Description
growth differentiation factor 15 Gene [Source:MGI (curated);Acc:Gdf15-002]
RefSeq_dna
NM_011819 
RefSeq_peptide
NP_035949.2 
UniGene
Mm.31325 
MGI
MGI:1346047 
Uniprot/SWISSPROT
Q9Z0J7 
Uniprot/SPTREMBL
Q3TU76 Q3UNI4 Q6NX63 
Human Ortholog
ENSG00000130513 (GDF15)
Omim not available
UniTrap UNI27002
Vector Insertion
Chr 8: 73154074 - 73155231
Public Clones not available
Private Clones OST79475 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110103
Sequence
CTTGATGACACCTGGTGCCCCTCCTTGCTCACTCCTGTCTTCCCCAGAGGCCCTAACTACAGCCACTACCCTTTCAGGGCCCAGGCTGACCGTGGATGGG

GCTCCTGGCACCTTCATCCTCCTCCTCCATCTTCTATCTGAGCCTGAGACGAACTGCCCACCCCCTCCAGCCACCTGCCGCCTCCTGTTTGGAAGGAGGC

CCGCAGCAGATTTCCTCTTCCCTCCATTCCCAAGAGGAACCCCTGGTCTGGGGATACTGAGGCAGGCACAGGGCAGGGCACGTGTGAGCATCCAGTCATC

CTGAAAG GACACAAGCGACATGGCCCCGCCCGCGCTCCAGGCCCAGCCTCCAGGCGGCTCTCAACTGAGGTTCCTGCTGTTCCTGCTGCTGTTGCTGCT

GCTGCTGTCATGGCCATCGCAGGGGGACGCCCTGGCAATGCCTGAACAGCGACCCTCCGGCCCTGAGTCCCAACTCAACGCCGACGAGCTACGGGGTCGC

TTCCAGGACCTGCTGAGCCGGCTGCATGCCAACCAGAGCCGAGAGGACTCGAACTCAGAACCAAGTCCTGACCCAGCTGTCCGGATACTCAGTCCAGAGG

 - UNI27002 - TGAGATTGGGGTCCCACGGCCAGCTGCTACTCCGCGTCAACCGGGCGTCGCTGAGTCAGGGTCTCCCCGAAGCCTACCGCGTGCAC

CGAGCGCTGCTCCTGCTGACGCCGACGGCCCGCCCCTGGGACATCACTAGGCCCCTGAAGCGTGCGCTCAGCCTCCGGGGACCCCGTGCTCCCGCATTAC

GCCTGCGCCTGACGCCGCCTCCGGACCTGGCTATGCTGCCCTCTGGCGGCACGCAGCTGGAACTGCGCTTACGGGTAGCCGCCGGCAGGGGGCGCCGAAG

CGCGCATGCGCACCCAAGAGACTCGTGCCCACTGGGTCCGGGGCGCTGCTGTCACTTGGAGACTGTGCAGGCAACTCTTGAAGACTTGGGCTGGAGCGAC

TGGGTGCTGTCCCCGCGCCAGCTGCAGCTGAGCATGTGCGTGGGCGAGTGTCCCCACCTGTATCGCTCCGCGAACACGCATGCGCAGATCAAAGCACGCC

TGCATGGCCTGCAGCCTGACAAGGTGCCTGCCCCGTGCTGTGTCCCCTCCAGCTACACCCCGGTGGTTCTTATGCACAGGACAGACAGTGGTGTGTCACT

GCAGACTTATGATGACCTGGTGGCCCGGGGCTGCCACTGCGCTTGAGCACCGGGCCCTGCTCCTCACCTACACTCCCCTTCAAGGATGCTATTTATATTT

GTATTTATTAATATTATTAATTTATTGGGGTCGGGCTGGGTGGATGGATTGTGTATTTATTTAAAACTCTGCTAATAAAGGTGAGCTTGGTTTCT
Translation
 MAPPALQAQPPGGSQLRFLLFLLLLLLLLSWPSQGDALAMPEQRPSGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEV - UN

I27002 - VRLGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLTPPPDLAMLPSGGTQLELRLRVAAG

RGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTD

SGVSLQTYDDLVARGCHCA
Transcript ENSMUST00000003808
Sequence
AGGAGTCCCACAGAGGACACCGAAGAGGTGCAGTCCCTGATTTGTCCTTATGTCCCAGCCCATTTGGGCACGGCTGTAATGTCTACTCCTGGGACACTGA

GGCATAGGGGTGACTTGCCTGAACTTGCCTTTTCTAGGTTTTCCTTGGCTTCACCTTTGATGGGGGTGGAGGGAGGAGGGAGGGAGAGAGGAGGAAAGAG

AGAGGGAGAGAGTCCTGGTCCCAAGAGGAAGGAAGAAGCCACTTGAACTTCAGTCTGGACTCCATCACATGTTCTGTGGGGACGATCAGCCCTCACTCAG

GTCCCAGCCCGGCGGTTTCCCTCCCTCCCACCCCCTCCCCCTGCGGAGCCCTGGGATTCCCGCCCGAATTAGCCTGGTCACCCGAGTTGGCATCGCACAC

GGGGGCGGAGCGGACAGAGTCCAGTGGGTATAAAGGCAGCTGCAGAGGGCTTAACTCAAAGACACACTCAGGACACAAGCGACATGGCCCCGCCCGCGCT

CCAGGCCCAGCCTCCAGGCGGCTCTCAACTGAGGTTCCTGCTGTTCCTGCTGCTGTTGCTGCTGCTGCTGTCATGGCCATCGCAGGGGGACGCCCTGGCA

ATGCCTGAACAGCGACCCTCCGGCCCTGAGTCCCAACTCAACGCCGACGAGCTACGGGGTCGCTTCCAGGACCTGCTGAGCCGGCTGCATGCCAACCAGA

GCCGAGAGGACTCGAACTCAGAACCAAGTCCTGACCCAGCTGTCCGGATACTCAGTCCAGAGG - UNI27002 - TGAGATTGGGGTCCCACGGCCAG

CTGCTACTCCGCGTCAACCGGGCGTCGCTGAGTCAGGGTCTCCCCGAAGCCTACCGCGTGCACCGAGCGCTGCTCCTGCTGACGCCGACGGCCCGCCCCT

GGGACATCACTAGGCCCCTGAAGCGTGCGCTCAGCCTCCGGGGACCCCGTGCTCCCGCATTACGCCTGCGCCTGACGCCGCCTCCGGACCTGGCTATGCT

GCCCTCTGGCGGCACGCAGCTGGAACTGCGCTTACGGGTAGCCGCCGGCAGGGGGCGCCGAAGCGCGCATGCGCACCCAAGAGACTCGTGCCCACTGGGT

CCGGGGCGCTGCTGTCACTTGGAGACTGTGCAGGCAACTCTTGAAGACTTGGGCTGGAGCGACTGGGTGCTGTCCCCGCGCCAGCTGCAGCTGAGCATGT

GCGTGGGCGAGTGTCCCCACCTGTATCGCTCCGCGAACACGCATGCGCAGATCAAAGCACGCCTGCATGGCCTGCAGCCTGACAAGGTGCCTGCCCCGTG

CTGTGTCCCCTCCAGCTACACCCCGGTGGTTCTTATGCACAGGACAGACAGTGGTGTGTCACTGCAGACTTATGATGACCTGGTGGCCCGGGGCTGCCAC

TGCGCTTGAGCACCGGGCCCTGCTCCTCACCTACACTCCCCTTCAAGGATGCTATTTATATTTGTATTTATTAATATTATTAATTTATTGGGGTCGGGCT

GGGTGGATGGATTGTGTATTTATTTAAAACTCTGCTAATAAAGGTGAGCTTGGTTTCT
Translation
MAPPALQAQPPGGSQLRFLLFLLLLLLLLSWPSQGDALAMPEQRPSGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEV - UNI

27002 - VRLGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLTPPPDLAMLPSGGTQLELRLRVAAGR

GRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDS

GVSLQTYDDLVARGCHCA

For any suggestions or comments, please send an email to unitrap@crg.es