Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038515 (Grtp1)
Chromosomal location
Chr 8: 13175162 - 13200620 (-)
Description
GH regulated TBC protein 1 Gene [Source:MGI Symbol;Acc:MGI:1914040]
RefSeq_dna
NM_025768 
RefSeq_peptide
NP_080044.2 
UniGene
Mm.34901 Mm.407617 
MGI
MGI:1914040 
Uniprot/SWISSPROT
Q9D3N8 
Human Ortholog
ENSG00000139835 (GRTP1)
Omim not available
UniTrap UNI26328
Vector Insertion
Chr 8: 13200201 - 13200480
Public Clones not available
Private Clones OST124913 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18589
Vector Insertion
Chr 8: 13192209 - 13200048
Public Clones (sanger) IST14481G5 (tigm) IST14715H5 (tigm) IST14948G8 (tigm)
Private Clones OST420151 (lexicon) OST364077 (lexicon) OST301634 (lexicon) OST278890 (lexicon)
OST124004 (lexicon) OST105554 (lexicon) OST53936 (lexicon) OST48636 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27089
Vector Insertion
Chr 8: 13189748 - 13192049
Public Clones IST10098H1 (tigm)
Private Clones OST72003 (lexicon) OST63641 (lexicon) OST45724 (lexicon) OST32294 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15972
Vector Insertion
Chr 8: 13177143 - 13179322
Public Clones not available
Private Clones OST469143 (lexicon) OST232071 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000081917
Sequence
AGCACTCGCGCGCCCCGGGGCCAGCGGCGCACCGGGGTCCAGCGCTCGGGGCTGCAGAGGTTGTGAGTCCCGCGGTCCCTGGCCCTTCTCCGCATGGATC

CCGCAGAGCGCGCGCAGGCGGCGCGAGCTCGGGTGCCCAG - UNI26328 - GATCGATCCGTATGGGTTTGAAAGGCCCGAAGACTTTGACTATGCG

GCTTATGAAGAATTCTTTTCCACGTACCTGGTGATACTCACCAAGAGGGCGATCAAATGGTCCAAACTTCTAAAAGGAAACGGTGGTGTCCGGAAAAGCG

TGACAG - UNI18589 - TGAAGCGCTATGTCCGGAAGGGAATCCCGCTGGAGCATCGGGCCCGTGTGTGGATGGCCGTGAGTGGAGCTCAGGCCCGG

ATGGACCAGAGCCCTGGATACTACCATCGACTGCTCGAGGGCGAGAGCAGCTCCAGCCTGGACGAGGCCATCAGGACAG - UNI27089 - ACTTGAA

CCGGACATTCCCTGACAACGTGATGTTTCGGAAGACAGCGGATCCTTGTCTCCAGAAGACCCTGTACAACGTGCTCCTGGCATATGGGCTACACAACCCA

GACGTGGGGTACTGCCAG GGAATGAATTTCATAGCTGGGTATCTGATCCTTATCACGAAGAATGAAGAGGAGTCTTTCTGGCTTTTGGACGCTCTTGTT

GGAAGGATACTACCTG ATTACTATAGCCCAGCAATGCTGGGGCTGAAGACTGACCAAGAGGTCCTAGCAGAGCTGGTGAGGATGAAGCTACCAGCAGTG

GCAGCCCTGATGGATGGCCATGGTGTGTTGTGGACCCTGCTGGTGTCCCGCTGGTTCATCTGCCTGTTTGTGGACATCCTACCTGTGGAG ACGGTGCTA

CGGATCTGGGACTGTCTGTTCAATGAGGGCTCCAAAATCATATTCCGGGTTGCTCTGACCTTAATTAAGCAACACCAGGAATTTATATTGGAAGCCAGCA

GTATTCCAGACATCTGTGACAAGTTTAAGCAGATCACCAAAGGGGACTTTGTGACAGAGTGTCACGCATTCATGCAG - UNI15972 - AAAATCTTT

TCAGAACCAGGAAGCCTGTCCATGACGACCATCACCAGGCTTCGGAAGAGCTGCCGAGCAGCGCTGCAGGCACAGAGCTGAGTGCACAGGCGCCCACAGC

TGCAGTTCTCTTCAGAGCACACACTTCACCAATTCCTACCACAACGTTCCTGCTGTAAATACTTGAAATCACGACACTCAATGTGAACTTTTAAAAGAAT

GACTTAAAATTAGTGTTCTCCATTTTTTCCTACCTTTGGAGTCATAAACTGAATTCTCTGGCCCAGCTTCATGATCTTAGTTGGGTCCCAGGACCCATAA

GTGGAAGCAGAGAACACTTGTTCAAATGGTCATTTTGAGACACACACACACTCGCGCATTCAAAAAAATCTTATTTTGACACTAGGAATATGAGGTACTT

GTTGAGGAGAGCAACAAGTTTCCTAGTGTTAGAAGTTAAGTGTCTGCCACGTGTGACCTTGGCTTCTCAGGCGAATAAGATCCCCAGCGCCCTCCCAGGA

CATTCTCCTAGCCTGTGCCTATGCAGACCTGTGCCCTATGGGGGTTAAGCGGGACACAGTAGCCTACTTCTGAGCATGGTCACTTGTGATGATCCCCGGC

TTTCTCAGAATGGCCCTTATAGGTAGGGCCCTGTCCTCTGGCTGCTCACCCCTAATGTCCTTACATACCCAGCACAGCCTATAAGGCCATCACTGATATC

CCCTGGTGAAGGCTATTCATGAAGCTGGAGGGCAGGCCTCATTCACTGGCAGTAAGCCCTGAGCCCCTTACCTTGCAGCTTCCTTTCTGGTTTTTCAAAG

CTGTAGCCTTAGCTGGGAGGCATGATGTACTAGCTCCGCCCAGGAGTGGATGGGCTCAGAGCTGCACCCACACTACTGTCCAGATGTCCCCCAAGGTCGT

TTGTACCTTAAAGGTGTACCTGGAGATGGCTTTCCTCAGGACTACCTGGTGTCACCTGCCAAGGAGAATGCTGGGGCCCCAGGGAGATGGAATTCAGTCC

CACTGAGATCTCATGGTCAGTCTGAGTGCAGAGATTCAAGGAACAAAGCTCCCTTCAGCTCAGTCCTCCCTTTCAGAGGGCTGATGTGAGCTGCTCCTGC

TTCCAGTCAGACCAGGAAGGTAGAGCCTGCAACCCTGCCAGTGACCCCAACAAGCAAGCCTGGAGGCCAGGCTTTCCTCTCCCCAAAGGCAGGACTGGGA

AGCTAAGTTACAAGACCCACAGGCAGACCTTGCCCTTGCCTGCCAGTCTGGATTCTCTGGACTGCTTTTGGTTTCTGAAGCTGATCAGAGGCACGTGATG

CTTCTAAGGCAAGGCTCCTGTTGTCTCCTGCCCCCAGAGGAGGGAGCTGGCCTACAGGATAGATGGAACACTTGAAGATGGTGGATGCTCCCAAGTCTTT

ACAAATCCCACCAGCAAGCAGAGGAGATACTGCAGAGGAGCCTGGCTTGTCCCAGTCTGCTATGGACATAAGGAGGTGGACAGATCAGAGCTTCAAGGAA

ACAGTGAGCACTGGCCTCTTCAAGTCACCTCATGTTTAATGTGTATAAGGTTCTTGTGACATAGGTGCAGTGCTTCTGGAGACTAGTCACATGGCCATAT

TCTCATCACCTAAGACTCATCAAAACAACAAATTATGTAAGTCTCCTAACATTTAGAGCCATGACAAGCAACATTTCCTTAACAAAACAACATTTAGTCT

TTTCATAGGCTGACTAGAAGCCGGGTTATCCCGACATTGTCCCATACCTTGTGCACATGAGGGCTCTCTTGATGGGTCACAGAAGGACACGTCCAGACAG

ACAAAGAAGGAGACTTTTTATTAGCATCGTTACAGGCAATGCATTACGTGAGCTGATGCCCAGTGTACAACCCACCTACGCTGCAAGACACGTCAGCAGT

GTGAATCTATTATTGTACACAGTGCAGAGACAGGGCCACCCTGAACGCCAACACAAGACTGGAAATCACTTT
Translation
MDPAERAQAARARVPR - UNI26328 - RIDPYGFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGGVRKSVTV - UNI18589 - VKRY

VRKGIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGESSSSLDEAIRTD - UNI27089 - DLNRTFPDNVMFRKTADPCLQKTLYNVLLAYGLHNP

DVGYCQ GMNFIAGYLILITKNEEESFWLLDALVGRILPD DYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVE 

TVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSIPDICDKFKQITKGDFVTECHAFMQ - UNI15972 - KIFSEPGSLSMTTITRLRKSCRAA

LQAQS
Transcript ENSMUST00000080568
Sequence
AGCACTCGCGCGCCCCGGGGCCAGCGGCGCACCGGGGTCCAGCGCTCGGGGCTGCAGAGGTTGTGAGTCCCGCGGTCCCTGGCCCTTCTCCGCATGGATC

CCGCAGAGCGCGCGCAGGCGGCGCGAGCTCGGGTGCCCAG - UNI26328 - GATCGATCCGTATGGGTTTGAAAGGCCCGAAGACTTTGACTATGCG

GCTTATGAAGAATTCTTTTCCACGTACCTGGTGATACTCACCAAGAGGGCGATCAAATGGTCCAAACTTCTAAAAGGAAACGGTGGTGTCCGGAAAAGCG

TGACAG - UNI18589 - TGAAGCGCTATGTCCGGAAGGGAATCCCGCTGGAGCATCGGGCCCGTGTGTGGATGGCCGTGAGTGGAGCTCAGGCCCGG

ATGGACCAGAGCCCTGGATACTACCATCGACTGCTCGAGGGCGAGAGCAGCTCCAGCCTGGACGAGGCCATCAGGACAG - UNI27089 - ACTTGAA

CCGGACATTCCCTGACAACGTGATGTTTCGGAAGACAGCGGATCCTTGTCTCCAGAAGACCCTGTACAACGTGCTCCTGGCATATGGGCTACACAACCCA

GACGTGGGGTACTGCCAG TGCTGCGCACAGAAACCTGGGTCTTCCGCAGGATTGCGAAGTTCTCTGACA GGAATGAATTTCATAGCTGGGTATCTGAT

CCTTATCACGAAGAATGAAGAGGAGTCTTTCTGGCTTTTGGACGCTCTTGTTGGAAGGATACTACCTG ATTACTATAGCCCAGCAATGCTGGGGCTGAA

GACTGACCAAGAGGTCCTAGCAGAGCTGGTGAGGATGAAGCTACCAGCAGTGGCAGCCCTGATGGATGGCCATGGTGTGTTGTGGACCCTGCTGGTGTCC

CGCTGGTTCATCTGCCTGTTTGTGGACATCCTACCTGTGGAG ACGGTGCTACGGATCTGGGACTGTCTGTTCAATGAGGGCTCCAAAATCATATTCCGG

GTTGCTCTGACCTTAATTAAGCAACACCAGGAATTTATATTGGAAGCCAGCAGTATTCCAGACATCTGTGACAAGTTTAAGCAGATCACCAAAGGGGACT

TTGTGACAGAGTGTCACGCATTCATGCAG - UNI15972 - AAAATCTTTTCAGAACCAGGAAGCCTGTCCATGACGACCATCACCAGGCTTCGGAAG

AGCTGCCGAGCAGCGCTGCAGGCACAGAGCTGAGTGCACAGGCGCCCACAGCTGCAGTTCTCTTCAGAGCACACACTTCACCAATTCCTACCACAACGTT

CCTGCTGTAAATACTTGAAATCACGACACTCAATGTGAACTTTTAAAAGAATGACTTAAAATTAGTGTTCTCCATTTTTTCCTACCTTTGGAGTCATAAA

CTGAATTCTCTGGCCCAGCTTCATGATCTTAGTTGGGTCCCAGGACCCATAAGTGGAAGCAGAGAACACTTGTTCAAATGGTCATTTTGAGACACACACA

CACTCGCGCATTCAAAAAAATCTTATTTTGACACTAGGAATATGAGGTACTTGTTGAGGAGAGCAACAAGTTTCCTAGTGTTAGAAGTTAAGTGTCTGCC

ACGTGTGACCTTGGCTTCTCAGGCGAATAAGATCCCCAGCGCCCTCCCAGGACATTCTCCTAGCCTGTGCCTATGCAGACCTGTGCCCTATGGGGGTTAA

GCGGGACACAGTAGCCTACTTCTGAGCATGGTCACTTGTGATGATCCCCGGCTTTCTCAGAATGGCCCTTATAGGTAGGGCCCTGTCCTCTGGCTGCTCA

CCCCTAATGTCCTTACATACCCAGCACAGCCTATAAGGCCATCACTGATATCCCCTGGTGAAGGCTATTCATGAAGCTGGAGGGCAGGCCTCATTCACTG

GCAGTAAGCCCTGAGCCCCTTACCTTGCAGCTTCCTTTCTGGTTTTTCAAAGCTGTAGCCTTAGCTGGGAGGCATGATGTACTAGCTCCGCCCAGGAGTG

GATGGGCTCAGAGCTGCACCCACACTACTGTCCAGATGTCCCCCAAGGTCGTTTGTACCTTAAAGGTGTACCTGGAGATGGCTTTCCTCAGGACTACCTG

GTGTCACCTGCCAAGGAGAATGCTGGGGCCCCAGGGAGATGGAATTCAGTCCCACTGAGATCTCATGGTCAGTCTGAGTGCAGAGATTCAAGGAACAAAG

CTCCCTTCAGCTCAGTCCTCCCTTTCAGAGGGCTGATGTGAGCTGCTCCTGCTTCCAGTCAGACCAGGAAGGTAGAGCCTGCAACCCTGCCAGTGACCCC

AACAAGCAAGCCTGGAGGCCAGGCTTTCCTCTCCCCAAAGGCAGGACTGGGAAGCTAAGTTACAAGACCCACAGGCAGACCTTGCCCTTGCCTGCCAGTC

TGGATTCTCTGGACTGCTTTTGGTTTCTGAAGCTGATCAGAGGCACGTGATGCTTCTAAGGCAAGGCTCCTGTTGTCTCCTGCCCCCAGAGGAGGGAGCT

GGCCTACAGGATAGATGGAACACTTGAAGATGGTGGATGCTCCCAAGTCTTTACAAATCCCACCAGCAAGCAGAGGAGATACTGCAGAGGAGCCTGGCTT

GTCCCAGTCTGCTATGGACATAAGGAGGTGGACAGATCAGAGCTTCAAGGAAACAGTGAGCACTGGCCTCTTCAAGTCACCTCATGTTTAATGTGTATAA

GGTTCTTGTGACATAGGTGCAGTGCTTCTGGAGACTAGTCACATGGCCATATTCTCATCACCTAAGACTCATCAAAACAACAAATTATGTAAGTCTCCTA

ACATTTAGAGCCATGACAAGCAACATTTCCTTAACAAAACAACATTTAGTCTTTTCATAGGCTGACTAGAAGCCGGGTTATCCCGACATTGTCCCATACC

TTGTGCACATGAGGGCTCTCTTGATGGGTCACAGAAGGACACGTCCAGACAGACAAAGAAGGAGACTTTTTATTAGCATCGTTACAGGCAATGCATTACG

TGAGCTGATGCCCAGTGTACAACCCACCTACGCTGCAAGACACGTCAGCAGTGTGAATCTATTATTGTACACAGTGCAGAGACAGGGCCACCCTGAACGC

CAACACAAGACTGGAAATCACTTT
Translation
MDPAERAQAARARVPR - UNI26328 - RIDPYGFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGGVRKSVTV - UNI18589 - VKRY

VRKGIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGESSSSLDEAIRTD - UNI27089 - DLNRTFPDNVMFRKTADPCLQKTLYNVLLAYGLHNP

DVGYCQ CCAQKPGSSAGLRSSLT GMNFIAGYLILITKNEEESFWLLDALVGRILPD DYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTL

LVSRWFICLFVDILPVE TVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSIPDICDKFKQITKGDFVTECHAFMQ - UNI15972 - KIFSEP

GSLSMTTITRLRKSCRAALQAQS

For any suggestions or comments, please send an email to unitrap@crg.es