Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038521 (C1s)
Chromosomal location
Chr 6: 124480407 - 124586997 (-)
Description
complement component 1, s subcomponent Gene [Source:MGI Symbol;Acc:MGI:1355312]
Human Ortholog
not available
Omim not available
UniTrap UNI38465
Vector Insertion
Chr 6: 124491350 - 124586185
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100963
Sequence
GCTTAACTGCATGACCAGAGGCAGGAGAGGAGGCTGGCCCACTTGTTCCCATCAGCTCCTGTAG - UNI38465 - GTGACACTGAGCCCTGGGTGGT

CCCTCACTACCAAAGCAGGCACCTGTACTTGTCAGATAAAGACAGCCAGGACTGCTGACTGCCCTTTACTTCCAAAATCAG - UNI38465 - AGAGC

CAGAGAGCCAGAGAGCCATGGGCAAATCGCCAGGGATGTG - UNI38465 - GTGTTTGGTCCTGTTTTCTCTTTTGGCATCATTTTCTGCTGAGCCC

ACCATGCATGGGGAGATCCTGTCCCCTAATTATCCCCAGGCGTACCCCAATGACGTCGTGAAATCTTGGGACATTGAAGTCCCAGAGGGGTTTGGGATTC

ACCTTTACTTTACCCATGTGGACATAGAGCCGTCAGAGAGCTGTGCATACGACTCAGTGCAG ATAATCTCAGGAGACATCGAGGAAGGGAGACTCTGTG

GCCAGAGGACCAGCAAGAGCCCCAACTCCCCCATTATAGAAGAGTTTCAGTTCCCATACAATAAACTTCAGGTGGTCTTTACCTCAGACTTCTCCAACGA

AGAACGGTTTACGGGCTTTGCAGCATACTACACTGCCATAG TGGTGCAGGACTGTAA AAGTAAAGAGAACGCTGTTGAGACAG GATTGT ATGTCCC

CTGTAGCCACTTCTGCAATAACTTCATTGGTGGATACTTCTGCTCCTGTCCCCCAGAATACTTCCTCCACGATGACATGAGGAATTGTGGAG TCAACTG

TAGTGGAGATGTGTTCACTGCCCTGATTGGGGAGATCTCAAGTCCCAATTATCCCAATCCATACCCGGAGAACTCAAGGTGTGAATACCAGATTCAGCTG

CAGGAGGGCTTCCAAGTGGTGGTGACGA CCCTTTCTATTTTTGTATTTCAGCACAATGTTTCCTTGAATTGCCCAAG TGTTTCCTTCCAGTTTGCTTC

AAAAAACCAACAGTTTGGTCCTTACTGTGGTAATGGGTTCCCTGGACCGCTAACTATTAGAACCCAGAGCAATACTCTCGGCATTGTCTTTCAAACTGAC

CTAATGGGGCAAAAGAAGGGTTGGAAGCTTCGTTACCATGGAGATC CCATCTCCTGTGCCAAAAAAATCACTGCCAATTCTACTTGGCAGCCCGATAAG

GCAAAATACGTGTTTAAAGATGTGGTGAAGATAACCTGTGTGGACGGATTTGAAGTTGTGGAG GGACATGTTAGCTCTACTTCATACTATTCCACTTGT

CAAAGCGATGGACAGTGGAGCAACTCCGGTCTAAAATGTCAAC CTGTGTATTGTGGAATTCCAGATCCCATTGCGAATGGTAAAGTTGAAGAGCCAGAG

AATAGTGTGTTTGGTACTGTTGTTCACTACACGTGTGAAGAGCCATATTACTACATGGAACATGAAGAAGGTG CATCTACCTG TATTCTAGGGGAGTA

TCGATGTGCTGCAAATGGGAGATGGGTAAATGACCAGCTGGGTATTGAGCTTCCAAGATGTATTCCAG CCTGTGGAGTACCCACCGAGCCCTTTCAAGT

GCATCAGAGGATATTTGGAGGACAACCTGCAAAGATTGAAAATTTTCCCTGGCAAGTCTTCTTTAATCACCCCAGAGCTAGTGGGGCTCTTATTAATGAG

TACTGGGTGCTGACGGCTGCTCACGTTTTGGAGAAAATCTCCGACCCTTTAATGTATGTCGGGACCATGTCTGTGAGGACAACTCTCTTGGAAAATGCCC

AGAGACTCTACAGTAAACGTGTCTTTATTCATCCCAGCTGGAAGAAAGAAGATGACCCAAACACACGGACAAATTTTGACAATGACATTGCCCTGGTGCA

GCTGAAAGACCCTGTGAAAATGGGACCCAAAGTCTCCCCCATCTGCCTACCAGGCACCTCCTCAGAGTACAACGTCTCACCGGGTGACATGGGGCTGATC

TCAGGGTGGGGCAGTACAGAAAAGAAAGTCTTTGTTATCAACCTCAGAGGGGCAAAGGTACCAGTAACCTCTTTAGAAACCTGCAAACAGGTGAAAGAGG

AGAACCCCACTGTAAGGCCTGAGGACTATGTTTTCACTGACAACATGATCTGTGCTGGCGAGAAAGGTGTTGACAGCTGTCACGGGGACAGCGGCGGGGC

TTTTGCTTTCCAGGTCCCCAATGTCACGGTCCCCAAATTCTATGTAGCTGGCTTGGTGTCTTGGGGGAAAAGGTGTGGGACTTATGGGGTCTACACAAAG

GTAAAGAATTACGTGGACTGGATCCTGAAAACTATGCAGGAGAATAGTGGGCCCAGGAAGGACTAATCCGTAGGGCGACAACTCCCCTCAAGGGCATAGC

AAGCTCACTGTTCTCAGATCCTATGGTGGTCCCCTTATTTCACAACGATGGAGAGAAGATGTGGGAGTATGGTTAATGCTGAACTTGATTGTCAAAGAGT

CTGCATGGAGGCAGGGTTGATCACTGAGCCGTGTTGGTTATTCAGTTACTATTGCTAACAACATGGCAGAAACCCTTCTATCTTGCGCTATTCCACAGGG

ATATCTTATCCGATCTTCCCTCATTTAACCTGCTTGAAATTCCTGAATAATTTACAGCAAAGCATGCTTCCAACCTGGTTCTGGCTGTATGGAGAGCCAC

GAAGGGAGAGAGGGAGATTTGGGGGCATAGCATCATGGAATTCAGGCATCAACAGCATGGAACTCTGCATCTCTAACAAGATGCAGACAGGGAACACAGC

CTTTTATTCTTTCTAGTGAGACTTACCGAATACTCAGAAGTTAGAAATGACTACCTTAGTTTTTCTCTGTGAGTTGCTTCAATATATTTCCTAGAAATTA

ATTTTCTTGTAATCCTCCTTT
Translation
 - UNI38465 -  - UNI38465 -  - UNI38465 - MHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQ IISG

DIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIV VVQDCK KSKENAVETG GLY YVPCSHFCNNFIGGYFCSCPP

EYFLHDDMRNCGV VNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTT TLSIFVFQHNVSLNCPS SVSFQFASKNQQFGPYCGNGF

PGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDP PISCAKKITANSTWQPDKAKYVFKDVVKITCVDGFEVVE GHVSSTSYYSTCQSDGQWSNSGL

KCQP PVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGA ASTC CILGEYRCAANGRWVNDQLGIELPRCIPA ACGVPTEPFQVHQRI

FGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDP

VKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQ

VPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD
Transcript ENSMUST00000077416
Sequence
GCTTAACTGCATGACCAGAGGCAGGAGAGGAGGCTGGCCCACTTGTTCCCATCAGCTCCTGTAG - UNI38465 - GTGACACTGAGCCCTGGGTGGT

CCCTCACTACCAAAGCAGGCACCTGTACTTGTCAGATAAAGACAGCCAGGACTGCTGACTGCCCTTTACTTCCAAAATCAG - UNI38465 - AGAGC

CAGAGAGCCAGAGAGCCATGGGCAAATCGCCAGGGATGTG - UNI38465 - GTGTTTGGTCCTGTTTTCTCTTTTGGCATCATTTTCTGCTGAGCCC

ACCATGCATGGGGAGATCCTGTCCCCTAATTATCCCCAGGCGTACCCCAATGACGTCGTGAAATCTTGGGACATTGAAGTCCCAGAGGGGTTTGGGATTC

ACCTTTACTTTACCCATGTGGACATAGAGCCGTCAGAGAGCTGTGCATACGACTCAGTGCAG ATAATCTCAGGAGACATCGAGGAAGGGAGACTCTGTG

GCCAGAGGACCAGCAAGAGCCCCAACTCCCCCATTATAGAAGAGTTTCAGTTCCCATACAATAAACTTCAGGTGGTCTTTACCTCAGACTTCTCCAACGA

AGAACGGTTTACGGGCTTTGCAGCATACTACACTGCCATAG ACATAAATGAATGCACAGATTTTACAGATGTCCCCTGTAGCCACTTCTGCAATAACTT

CATTGGTGGATACTTCTGCTCCTGTCCCCCAGAATACTTCCTCCACGATGACATGAGGAATTGTGGAG TCAACTGTAGTGGAGATGTGTTCACTGCCCT

GATTGGGGAGATCTCAAGTCCCAATTATCCCAATCCATACCCGGAGAACTCAAGGTGTGAATACCAGATTCAGCTGCAGGAGGGCTTCCAAGTGGTGGTG

ACGATGCAGAGAGAAGATTTTGATGTGGAGCCCGCTGACTCAGAGGGGAACTGCCCTGACAGTTTAACT TTTGCTTCAAAAAACCAACAGTTTGGTCCT

TACTGTGGTAATGGGTTCCCTGGACCGCTAACTATTAGAACCCAGAGCAATACTCTCGGCATTGTCTTTCAAACTGACCTAATGGGGCAAAAGAAGGGTT

GGAAGCTTCGTTACCATGGAGATC CCATCTCCTGTGCCAAAAAAATCACTGCCAATTCTACTTGGCAGCCCGATAAGGCAAAATACGTGTTTAAAGATG

TGGTGAAGATAACCTGTGTGGACGGATTTGAAGTTGTGGAG GGACATGTTAGCTCTACTTCATACTATTCCACTTGTCAAAGCGATGGACAGTGGAGCA

ACTCCGGTCTAAAATGTCAAC CTGTGTATTGTGGAATTCCAGATCCCATTGCGAATGGTAAAGTTGAAGAGCCAGAGAATAGTGTGTTTGGTACTGTTG

TTCACTACACGTGTGAAGAGCCATATTACTACATGGAACATGAAGAAGGTG GGGAGTATCGATGTGCTGCAAATGGGAGATGGGTAAATGACCAGCTGG

GTATTGAGCTTCCAAGATGTATTCCAG CCTGTGGAGTACCCACCGAGCCCTTTCAAGTGCATCAGAGGATATTTGGAGGACAACCTGCAAAGATTGAAA

ATTTTCCCTGGCAAGTCTTCTTTAATCACCCCAGAGCTAGTGGGGCTCTTATTAATGAGTACTGGGTGCTGACGGCTGCTCACGTTTTGGAGAAAATCTC

CGACCCTTTAATGTATGTCGGGACCATGTCTGTGAGGACAACTCTCTTGGAAAATGCCCAGAGACTCTACAGTAAACGTGTCTTTATTCATCCCAGCTGG

AAGAAAGAAGATGACCCAAACACACGGACAAATTTTGACAATGACATTGCCCTGGTGCAGCTGAAAGACCCTGTGAAAATGGGACCCAAAGTCTCCCCCA

TCTGCCTACCAGGCACCTCCTCAGAGTACAACGTCTCACCGGGTGACATGGGGCTGATCTCAGGGTGGGGCAGTACAGAAAAGAAAGTCTTTGTTATCAA

CCTCAGAGGGGCAAAGGTACCAGTAACCTCTTTAGAAACCTGCAAACAGGTGAAAGAGGAGAACCCCACTGTAAGGCCTGAGGACTATGTTTTCACTGAC

AACATGATCTGTGCTGGCGAGAAAGGTGTTGACAGCTGTCACGGGGACAGCGGCGGGGCTTTTGCTTTCCAGGTCCCCAATGTCACGGTCCCCAAATTCT

ATGTAGCTGGCTTGGTGTCTTGGGGGAAAAGGTGTGGGACTTATGGGGTCTACACAAAGGTAAAGAATTACGTGGACTGGATCCTGAAAACTATGCAGGA

GAATAGTGGGCCCAGGAAGGACTAATCCGTAGGGCGACAACTCCCCTCAAGGGCATAGCAAGCTCACTGTTCTCAGATCCTATGGTGGTCCCCTTATTTC

ACAACGATGGAGAGAAGATGTGGGAGTATGGTTAATGCTGAACTTGATTGTCAAAGAGTCTGCATGGAGGCAGGGTTGATCACTGAGCCGTGTTGGTTAT

TCAGTTACTATTGCTAACAACATGGCAGAAACCCTTCTATCTTGCGCTATTCCACAGGGATATCTTATCCGATCTTCCCTCATTTAACCTGCTTGAAATT

CCTGAATAATTTACAGCAAAGCATGCTTCCAACCTGGTTCTGGCTGTATGGAGAGCCACGAAGGGAGAGAGGGAGATTTGGGGGCATAGCATCATGGAAT

TCAGGCATCAACAGCATGGAACTCTGCATCTCTAACAAGATGCAGACAGGGAACACAGCCTTTTATTCTTTCTAGTGAGACTTACCGAATACTCAGAAGT

TAGAAATGACTACCTTAGTTTTTCTCTGTGAGTTGCTTCAATATATTTCCTAGAAATTAATTTTCTTGTAATCCTCCTTT
Translation
 - UNI38465 -  - UNI38465 - MGKSPGMW - UNI38465 - WCLVLFSLLASFSAEPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIH

LYFTHVDIEPSESCAYDSVQ IISGDIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAID DINECTDFTDVPCSHFCN

NFIGGYFCSCPPEYFLHDDMRNCGV VNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLT FASKNQ

QFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDP PISCAKKITANSTWQPDKAKYVFKDVVKITCVDGFEVVE GHVSSTSYYSTCQ

SDGQWSNSGLKCQP PVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGG GEYRCAANGRWVNDQLGIELPRCIPA ACGVPTEPFQVHQ

RIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLK

DPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFA

FQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD

For any suggestions or comments, please send an email to unitrap@crg.es