Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038526 (Car14)
Chromosomal location
Chr 3: 95701723 - 95708562 (-)
Description
carbonic anhydrase 14 Gene [Source:MGI (curated);Acc:Car14-001]
RefSeq_dna
NM_011797 
RefSeq_peptide
NP_035927.1 
UniGene
Mm.306954 
MGI
MGI:1344341 
Uniprot/SWISSPROT
Q9WVT6 
Human Ortholog
ENSG00000118298 (CA14)
Omim not available
UniTrap UNI12976
Vector Insertion
Chr 3: 95706055 - 95708242
Public Clones CMHD-GT_353D3-3 (cmhd)
Private Clones OST403484 (lexicon) OST282004 (lexicon) OST160955 (lexicon) OST113336 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036181
Sequence
TGGCCAGTAAGTGGTGTGGAGATTACGAAGGGACATACGGAGAGGGCAGAGAGAGGAAGAGAGAGAAAGTGAGAGAGGAAGAAATTTATCCTGGGATCCA

GAAGTTCGTGTTAACCTGTGGAAAATCAAGTCCCTGGAAGTCTGCAGAGACAGAGACAAGAAGAAAAGAGATAGAACGCCAGAAACTCCTCTCTCTCCCT

CCCTCTCCACCTCTCTCTTCTAAACCCCAAATTCCTGGTCCCTTGTACCCCATTGTGGGGATAATATGTTGTTCTTCGCTCTCCTGTTAAAGGTGACTTG

GATCCTGGCTGCAGATGGGG - UNI12976 - GTCACCACTGGACATATGAAG GCCCACACGGTCAGGACCATTGGCCAACCTCTTATCCTGAGTGT

GGAGGCGATGCCCAGTCCCCCATCAATATCCAGACAGACAGTGTGATATTTGACCCCGATCTGCCTGCTGTACAGCCCCATGGATATGACCAGCTTGGGA

CTGAGCCTTTGGATCTACACAATAATGGCCATACAG TGCAGCTTTCCCTGCCCCCAACCCTGCACCTGGGTGGACTGCCCCGAAAATACACAGCAGCCC

AGCTCCACCTGCACTGGGGTCAGAGAGGATCCCTCGAGGGATCAGAGCACCAGATCAACAGTGAAGCCACGGCTGCGGAG CTCCACGTGGTTCACTATG

ACTCCCAGTCCTACAGCAGCTTGAGTGAGGCAGCTCAGAAGCCACAGGGCCTGGCTGTCCTAGGCATCCTCATTGAG GTGGGCGAGACTGAGAATCCAG

CTTATGATCACATTCTGAGTCGTCTACATGAAATAAGATACAAAG ATCAGAAGACCTCTGTGCCTCCCTTCAGCGTGAGAGAGCTGTTCCCCCAACAGC

TGGAGCAATTCTTCCGCTACAACGGCTCACTCACAACTCCCCCCTGCTACCAGAGTGTGCTCTGGACAGTCTTCAACAGAAGGGCCCAGATTTCAATGGG

ACAG TTAGAGAAGCTCCAGGAGACATTGTCCTCTACAGAAGAGGACCCCTCTGAGCCCCTTGTACAGAACTACAGAGTCCCCCAGCCTCTCAACCAGAG

GACCATCTTTGCTTCTTTCATCCAAG CAGGACCACTGTATACCACAG GAGAGATGCTGGGTCTAGGTGTGGGAATCTTGGCTGGATGTCTTTGCCTTC

TGCTGGCTGTTTATTTCATCGCTCAAAAAATTAG GAAGAAGCGGCTGGGAAACAGGAAAAGTGTGGTTTTCACCTCTGCTCGGGCTACCACAGAGGCGT

GAACTCTGTCTCAAGATGCTGCAGATGCCTCCCTCTCCTCCTGCCAGGGAGCCTCTCTGAGGGCTGCAGGCACTGGACGACCAGTTGTAGGCAGGCACGT

GTCCTGCTAGGTAACCCTCTCTATACACCAGGGACCCCAGCTCTTCAGGAAGGGCTGAGCCTTTGGCCTTCAAAGCTGTGGATGAGGAGATTCCCTGTCC

TCATGCTTGGTTGGAAGAAGCTGAGGATAAACTGCCATCTTTCACCTCACACCGCCATGTTCTCTCCCTTAGATATACGTTGTAGTTTTTTTTTTTCCTC

TAGGAAAAAAGGGCTGCTGCTGGGATTTTAATTATTTTTTGCTCAATA
Translation
MLFFALLLKVTWILAADGG - UNI12976 - GHHWTYEG GPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNG

HTV VQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAE LHVVHYDSQSYSSLSEAAQKPQGLAVLGILIE VGETENPAYDHILS

RLHEIRYKD DQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQ LEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFA

SFIQA AGPLYTTG GEMLGLGVGILAGCLCLLLAVYFIAQKIR RKKRLGNRKSVVFTSARATTEA

For any suggestions or comments, please send an email to unitrap@crg.es