Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038533 (Cbfa2t2)
Chromosomal location
Chr 2: 154262217 - 154365092 (+)
Description
core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human) Gene [Source:MGI (curated);Acc:Cbfa2t2-001]
RefSeq_dna
NM_172860 
RefSeq_peptide
NP_766448.1 NP_033953.1 
UniGene
Mm.471397 Mm.29914 Mm.414642 
MGI
MGI:1333833 
Uniprot/SWISSPROT
O70374 
Uniprot/SPTREMBL
B2RRH8 Q3UGB2 A2AKD9 A2AKE3 A2AKE4 
Human Ortholog
ENSG00000078699 (CBFA2T2)
Omim not available
UniTrap UNI124
Vector Insertion
Chr 2: 154262253 - 154262373
Public Clones GC0071 (tigem) GC0056 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36874
Vector Insertion
Chr 2: 154262253 - 154262373
Public Clones M061A08 (ggtc) (ggtc) Ayu21-W4 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5148
Vector Insertion
Chr 2: 154262373 - 154262579
Public Clones RRR101 (baygenomics) CSJ088 (baygenomics) XG579 (baygenomics) CSH693 (baygenomics)
XG531 (baygenomics) RRF565 (baygenomics) CSI657 (baygenomics) XE736 (baygenomics)
HMA219 (baygenomics) YTC178 (baygenomics) RRI043 (baygenomics) CSI658 (baygenomics)
XE801 (baygenomics) P110C07 (ggtc) P011A09 (ggtc) W068E05 (ggtc)
P022C12 (ggtc) A060B03 (ggtc) P096B05 (ggtc) W064F05 (ggtc) P023A08 (ggtc)
P015B09 (ggtc) F009D03 (ggtc) P066C01 (ggtc) W275A08 (ggtc) D016F07 (ggtc)
P029B03 (ggtc) W024G12 (ggtc) P022G02 (ggtc) W221E01 (ggtc) P025C12 (ggtc)
W087B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36409
Vector Insertion
Chr 2: 154262373 - 154262579
Public Clones (ggtc) IST14497F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6252
Vector Insertion
Chr 2: 154262785 - 154326135
Public Clones (sanger) CSD065 (baygenomics) P138F05 (ggtc) D095E04 (ggtc) D048G12 (ggtc)
D022H01 (ggtc) E047E10 (ggtc) D071H10 (ggtc) D039E04 (ggtc) D003H04 (ggtc)
P148A11 (ggtc) D106D10 (ggtc) D050B04 (ggtc) D030B04 (ggtc) P121C07 (ggtc)
D043C07 (ggtc) D016C07 (ggtc) E042D05 (ggtc) D057B04 (ggtc) D035E12 (ggtc)
P138F12 (ggtc) D099A03 (ggtc) D006D08 (ggtc) E037E11 (ggtc) D032D01 (ggtc)
D001C07 (ggtc) CMHD-GT_518D9-5S (cmhd) FHCRC-GT-S10-5A1 (fhcrc) PST21688-NL (escells)
PST1424-NR (escells) PST5236-NR (escells) IST14186F3 (tigm) IST13136D8 (tigm)
IST10318C7 (tigm) IST10927F5 (tigm) IST11785G11 (tigm) IST10913G5 (tigm)
IST10279C6 (tigm) IST10915A5 (tigm) IST12719C6 (tigm) IST14781A12 (tigm)
IST15059E7 (tigm) IST12839A1 (tigm) IST14347C5 (tigm) IST13572B4 (tigm)
IST14315G6 (tigm) IST14781A11 (tigm) IST11411H7 (tigm) IST12492D4 (tigm)
IST14409D6 (tigm) IST14873H8 (tigm) IST12541F7 (tigm) IST14972E1 (tigm)
IST10115B8 (tigm) IST11788A4 (tigm) IST14849C6 (tigm) IST10541G11 (tigm)
IST12015F11 (tigm) IST11667G7 (tigm) IST10038E3 (tigm) IST14070A7 (tigm)
IST11185A8 (tigm) IST14379E12 (tigm) IST12929D1 (tigm) IST10550A6 (tigm)
IST14995F11 (tigm) IST11188A3 (tigm) IST13897E10 (tigm) IST14665G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15813
Vector Insertion
Chr 2: 154326135 - 154326280
Public Clones not available
Private Clones OST472601 (lexicon) OST471772 (lexicon) OST470942 (lexicon) OST467803 (lexicon)
OST437691 (lexicon) OST427412 (lexicon) OST424537 (lexicon) OST422590 (lexicon)
OST420704 (lexicon) OST417054 (lexicon) OST406718 (lexicon) OST381286 (lexicon)
OST374897 (lexicon) OST369188 (lexicon) OST365586 (lexicon) OST360653 (lexicon)
OST355988 (lexicon) OST353030 (lexicon) OST352572 (lexicon) OST351452 (lexicon)
OST351359 (lexicon) OST351344 (lexicon) OST341637 (lexicon) OST325753 (lexicon)
OST321959 (lexicon) OST317498 (lexicon) OST316859 (lexicon) OST316749 (lexicon)
OST315359 (lexicon) OST301837 (lexicon) OST297251 (lexicon) OST276741 (lexicon)
OST276257 (lexicon) OST266807 (lexicon) OST262089 (lexicon) OST231900 (lexicon)
OST221963 (lexicon) OST220680 (lexicon) OST216763 (lexicon) OST216224 (lexicon)
OST173922 (lexicon) OST172300 (lexicon) OST164870 (lexicon) OST114814 (lexicon)
OST104715 (lexicon) OST100053 (lexicon) OST65857 (lexicon) OST60920 (lexicon)
OST56973 (lexicon) OST55587 (lexicon) OST46403 (lexicon) OST43637 (lexicon)
OST43573 (lexicon) OST37177 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6550
Vector Insertion
Chr 2: 154326280 - 154330288
Public Clones YHB076 (baygenomics) F028F04 (ggtc) IST11202A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21125
Vector Insertion
Chr 2: 154330288 - 154330531
Public Clones not available
Private Clones OST340596 (lexicon) OST233106 (lexicon) OST168387 (lexicon) OST121836 (lexicon)
OST121832 (lexicon) OST121828 (lexicon) OST121820 (lexicon) OST121815 (lexicon)
OST121814 (lexicon) OST121808 (lexicon) OST121799 (lexicon) OST121796 (lexicon)
OST121795 (lexicon) OST121781 (lexicon) OST121776 (lexicon) OST121765 (lexicon)
OST121757 (lexicon) OST121756 (lexicon) OST121753 (lexicon) OST121752 (lexicon)
OST121747 (lexicon) OST121740 (lexicon) OST121734 (lexicon) OST121715 (lexicon)
OST121714 (lexicon) OST121709 (lexicon) OST121704 (lexicon) OST121701 (lexicon)
OST121696 (lexicon) OST121684 (lexicon) OST121667 (lexicon) OST121655 (lexicon)
OST121651 (lexicon) OST121650 (lexicon) OST68335 (lexicon) OST30496 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8574
Vector Insertion
Chr 2: 154330531 - 154336243
Public Clones RRO470 (baygenomics) IST14825B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22506
Vector Insertion
Chr 2: 154336243 - 154336334
Public Clones not available
Private Clones OST294850 (lexicon) OST167691 (lexicon) OST149511 (lexicon) OST44806 (lexicon)
OST37823 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18817
Vector Insertion
Chr 2: 154336334 - 154341552
Public Clones D056C12 (ggtc)
Private Clones OST413680 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9418
Vector Insertion
Chr 2: 154343444 - 154343699
Public Clones RRD136 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9466
Vector Insertion
Chr 2: 154343444 - 154343561
Public Clones RRD128 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33366
Vector Insertion
Chr 2: 154354642 - 154356957
Public Clones IST11180B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI598
Vector Insertion
Chr 2: 154356960 - 154357149
Public Clones AZ0094 (sanger) RRH189 (baygenomics) RRH194 (baygenomics) RRH195 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22223
Vector Insertion
Chr 2: 154357149 - 154360619
Public Clones not available
Private Clones OST302984 (lexicon) OST167047 (lexicon) OST145224 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045270
Sequence
GCGGGTGCAGGTCCCGGCCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGCTCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCT

GGAGCGGCCGCCTTCCAAC - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - TTGGTT

GTGAGAAAAGGGTGCCAGCAATGCCTGGATCGCCTGTGGAAGTGAAGATACAGTCAAGATCCTCACCTCCCATCATGCCACCCCTCCCACCAATAAATCC

TGGAGGACCGAGGCCAGTGTCCTTTACTCCTACAGCAT - UNI6550 - - UNI15813 - - UNI21125 - TAAGCAATGGCATCAACCATTCC

CCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCCACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTA

CTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCAATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGAC

TCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTCAACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAG

GAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI18817 - - UNI22506 - GCCAACCTGCCCCTGCTGCAGCGAG

AACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCATGAGCACCTTCTGCTCAACACCAGTATCGCATCTCCTGCTGA

CTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG - UNI9418 - - UNI9466 - GAGGGACGAGAATAATTT

TGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCTGCTCCTCGGCACAGTCCCGCCCTCACTGTTCCCCTTATGAAT

CCTGGGGGCCAGTTCCATCCTACTCCACCACCTCTTCAGCACTATACACTAGAAGACATTGCAACTTCTCACCTGTATCGGGAACCAAACAAGATGCTAG

AACACCGAGAAGTTCGTGAGAGGCACCACAATCTTA - UNI9418 - GTCTCAATGGAGGCTATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAA

GGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCATTATGGAAATGGTAGAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCT

GTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAATGAAAATACAGAGTTGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCA

CAGCCCTGGGAGTACAGATTCTCTCAGCAACG ATTCTCAGCGGGAATTTACCAGTAGACCAGCAACAGGATATGTGCCTGTGGAGTTTTGGAAGAAAAC

AG - UNI33366 - AAGAAGCCGTGAATAAGGTGAAAATTCAGGCCATGTCAGAGGTACAGAAGGCTGTAGCTGAGGCAGAGCAAAAAGCCTTTGAAG

TGATTGCAACGGAGAGAGCTCGAATGGAGCAGACCATAGCGGATGTCAAACGGCAGGCTGCAGAAGATGCTTTCCTGGTCATCAATGAGCAAGAAGAGTC

CACAGAG - UNI598 - - UNI22223 - AACTGCTGGAACTGTGGCCGAAAAGCCAGTGAGACGTGCAGTGGCTGCAACATTGCTCGCTACTGCGG

CTCCTTCTGCCAGCATAAGGACTGGGAGCGGCACCACCGCCTCTGTGGCCAGAGTCTACATGGCCACAGTCCCCACAGCCAGAGCAGGCCACTGCTCCCT

GGAGGGCGGGGCTCAGCCAGGTCTGCTGACTGCAGTGTGCCCAGCCCAGCCCTGGACAAGACCTCAGCTACCACCTCACGGTCCTCAACACCTGCCTCTG

TGACAGCCATTGATGCCAACGGGCTCTAAGCTACAGACTCCACCTGTCCTGATGACCCCTCCACATGGGAGCATGCTTGCACCAGTGAGCTGGCTATTAG

AACAAGTAGCTGTTGGGTCGTCAGCAAGAAGTGAAGTTGGCAGGAAGCATCCAAGAGGCACTCCACAGCTTCTCTGGGATTTGCCACGTGTCCTTGGAAG

AACTAATGTATCATTCTCTGCACACAGGAAGTAGCTTGAGCTGCCTCCTCCATGGCTTTCCTGAGGTTCCTCTTCCAGCTAAAGCTGGCATAACCAGCCC

CTTCTCAGTGTATACACCAGCTCCCTCCGACTCCTTGCATTAGCATATTGTCAATAGTGTCCCACACTGTCCACAGTAGAGGCCTGAAGACTGGTAGCAG

GCTTAGGAGGAGGCCCTTCCTTCCCCTGTCTTCAAACAGTTCCTTGAGCCCCATATCCACCCTCGAGTGACACTGATTGGCCTAAAAGAGACTTGGATAG

CACAAAAGCAGTACTCAGGACTCTCTCCTGAGCTGCTCAGAGCTGTTAAGATGCTCAGAAATGCAAGAAAGAAGTCACTGTTTCAGTAAAATCTCTAGTA

ATGATAAAAAATTAAATTAGTCTTCCCAAGCATCATGGATCATTTTGGACAAGATTTTCTAACTTGGCTGTCTTCGTTAGTTTGGAACCCACCTCTTAAC

TCCAGTGTTTTTCTTGATTTTGCTTGTGTAAAAAATAATCTCCATCGCATGGATCGGTCTGAGAGAGGATGGAGCCATTGTGCTAGTCTTTTCTCTAAGC

ATGTTGGCCAAACTAAAATATTCCGTGGATCACCTTGGAAATGCAGAGCCTCTGCCACTGCTTGACTGTTTAAAACAGTCGCCTTGTTGTATGTGTCCTT

CTCTCTGGGACTGCATGTCTGGATCCTTGGGGATGTCTTGTGAGTAGGTTCTGTTTGGCACCTAAGCAGTGCTCCTAACCCTGATGGGATTATTCGCACC

TGGTTTTGACACCACCTCATAGGTTTATTATCAGGTGGACATTTGAGGCATCCTTTTTCTGTGCTCCGTGTTTATAGTCTCCCTCACAGCTCAGAGTTTG

TGAAGAATGGGAACCGTTTTTGAAGAGCCTGACCTGTTTTTTTTTTTTTTTTTTTTTTTTCCCATCTTCAGGAACTTTTCCAATTATCTGATTCTCCAAA

TAGAATTTGGAGACATCGATCTGGTCATTATTGGACCTATTGATCAGGCCAAGTACTGCTCACATCTTTTCCTTGCCATCTAAAGTTTATTAGTTGTCAG

CACCTTGCATCGGCCACTCAGTATACTCCAGAATCGTTTTGCCCTGTGCAGTCAATTGGGATAAGTCATTGCCTTTGATCCTGTTGGCTTTTGGAAGCTG

TGGTCACTTTTTGTACAATGAACAAGTCTGAAGAACAAGTCTGAATACTAACACTTGCCCCATAAAAGTATGGATTTAGTGTCTTTGCACACAGTTAAGG

CTGATTTAAAAATACTGAGTTCCTATCTCATTGGAACAAGGGTTCTCAGACTTAGAAAGTAGACCTTTAAAATCATGTTATTTTAGCATAGAATACCCAA

GACCCACTGTTTGCCAGACAGCTTAGTACAGCCTGGCCTCCCTGGTCCCATCCCATCAGTCTAGTGGGGACAACTTTGACTTACTAGATAGAGTTAGTAC

CAGACAGCACTTGTCCATACTCAGACACAAAACTTCGGGCAGATCAGGAGCTTCTGTGAACATGAGAATGTCTCCTGGTGTGCCCTGGTCAGTTACTCAG

TAGTAAAATGGATGAACACCCTTTAAGTGTTAAATTTTTTTGCCACAGAACTACTCCAGATAGTTGGAATAAAGAGCTAGAACCAATACATTACTACTTA

CCTGGTTGGAGATCAGTTTGTACAGCAAACTGGGTTACAAAATCTAGCCTACCTTTGTGGGCTGTGTGATTGGCCTGTCCGATTCTGAGTTTCTATAGTG

CTGTTGGGGACTGCTTTGCTTCTGTGTCCTACCCAGGTTTGTCTACACACTCGGACAGTACTTTACACTATATAGTTCAGTTCTCAGACTTGTCTCTATC

TTGCCTCTGGTCAGCATCACTCTCGGGGTTTTGTTTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTTTCGAGACAGGGTTTCTCCGTG

TAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCGGACTGGCCTTGAACTCAGAAATCCGCCTGCCTCTGCCTCCCAAGTGCTGAGATTAAAGGCATGC

ACTACCATGGCCCGGCTTCAGCATCACTCTTACGTGACATCTGTTTAGGACTTTTCAGATTTAAGGAGTTCCTTTCTGCAGTTCTCCAACTCCTCCCTAG

GCAGGAGCAGCAGCAGTAGGAGCTGGAGCTACAAGTGATTCCTGGCTCACCGCTTTGTTTCTAAGTCTGCTTATATGAGCCACCAGGCTGGGAGTGAACA

TAGAGCTTCAGGCTGCTCACAAGTCTGGCCTCTGCAGTAACTATTTGAGGAAGAAAAGTAGTCAGGGCTTGGTCATTCTGTACCAAGTGAGGGATAAAAT

TTCAGGAAGTAAATAACAAAAGTAGCCAAACTGGGAGTTCTGCACACCAGTCCTCGCTCCAGCAAATGAAGACTTGTTGAAGCTAGCTTGGGACATGGCT

TATTTGGTAGCATGGACTTCATTCCCAGTGTGGCATACACCAGCCATGGTGGCACATACCTGTAATCCTCTAACACTTAGGAGGTAGAAGCAGGAGGACC

AGAAGTTTAAGGTTATCCATAGCTGCATAGCAAGCCTGAGTTACAGGAGACTTATCCCACAGAGACTCATTGAAGGGCCCTGCAGCTTCAGATTGGCTCA

TGCAGGGAGGTGGAGGTGAGGGCGCAGGCTGTGAGTGGCTTTCTCCTAAGGTGCTAAGTTATGTGCAGCCATGGGTCTCCATGGAATAACCTGTCTGGCC

CCCCGAGGTCTATCCAGGCATTGGCTGTCAGTCTTCTGTAATGTAGACTCCTTTACCCATTTGATCCCCAGGGAGTGCTTCAAATCTTGATGTCAGCTTT

ACCGTCATTTCTTGTCACCTTCTCAGAGAGAGTGAAGACATTTTTTTCTGAGTGGTTCTGGAAACTATCTCAGCAGGTGTGTGAGGCCTCAACACAACTG

CAAGTGTGTGTTAGTGGTTCTCCCTAGAGCATAAGGAGTGAGCAGATGGCCTTCGTTCTGAAAACTGCAGACAGGATTGTGGGTTGAATAAACCTTTACA

AATAGGACACGTCTTGGAGGCTTACTTCAGAACTGGACTGGAACCAAGGTTTCCAGGCTCCTGGCTCAGGAGACTAAGCCAGTGTACTTTGATGAATGTT

AGCTATTTGCAGAGAACTGGGTGGTGGCATGTTTGAACCAAATGTGAGAAAAGCCAGAAGGAACTGAACTGGCCATTGTGGACCAGATGGCCAGCTGTGG

AAGATCCTTGATCCAGCAGCTGCTTAGCAGACCCTGGCCACTCAAGTATATTCCTTTAAAGCCAAAATGCTGACTACCTGCTTCTGCCTCATGTTGACAC

CCATTTCCAAAGATGATGGAGCCAGTGTGAGCCAGGAGGAAGCTGAGATGGTGGCTGATAATTTACTCTACCATCTCCTTCCACAGCCCAAGAGGTGGCA

CTTCCCGCTCAGACACCGTCTTATCAGGCCTCCAGCTGCCCAGTGTAAACTGTCAATGCTTATACCAAAAAGGGCATGTGCAGCTGGTGTCTGCCAGGGA

CAGCCCAGTCCCTGCCTTGTGGTTCCCAGGAAGAAGCTGCAACAATTCAGTGAATGATTAAAGGGCTGTTTGATAATAAGGCCTTCGTTCCACTCCTGTG

GCTTTCCAAGTTCCTAATGAGGCTACAAAGGCTCCATCCATACAGAAAACCAATAATGTAAATAAAAGCCAATCCTGCAAGCATGGTTTGCAGAGGCGGG

TGATGAATGTGAAGCCACCCGCAGGATGCATTTGAGTCTGGTTTTTCTGTGCTTTGTCATTTGACTCAGTAGGAACTTTTGTTACTTAACTCTGTGCATA

ACTTATTTAATGTACTGTATAAATGAACCAAAACTGTTAAATATGTATTTAGTTTGTTCTACTTAAAGTAGTTAATAAAAATGCTATATTCCTTTTCTGA

CTC
Translation
MVGVPGAAAFQL - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - LGCEKRVPAMPGS

PVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTAL - UNI6550 - - UNI15813 - - UNI21125 - LSNGINHSPPTLNGAPSPPQRFSNG

PASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALV - UNI8574 - - UNI21125 - - UNI22506 - NSTVT

IEEFHCKLQEATNFPLRPFVIPFLK - UNI18817 - - UNI22506 - ANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLM

EVHGNGKRPSPER - UNI9418 - - UNI9466 - RRDENNFERDTVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIAT

SHLYREPNKMLEHREVRERHHNLS - UNI9418 - SLNGGYQDELVDHRLTEREWADEWKHLDH ALNCIMEMVEKTRRSMAVLRRCQESDREELNYW

KRRFNENTELRKTGTELVSRQHSPGSTDSLSND DSQREFTSRPATGYVPVEFWKKTE - UNI33366 - EEAVNKVKIQAMSEVQKAVAEAEQKAFE

VIATERARMEQTIADVKRQAAEDAFLVINEQEESTE - UNI598 - - UNI22223 - NCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCG

QSLHGHSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL
Transcript ENSMUST00000109725
Sequence
GGCAGCGGCGGCGGCGGCGCTGGTGCGGGCGAGTTCGGCGGGTGCAGGTCCCGGCCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGC

TCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCTGGAGCGGCCGCCTTCCAAC - UNI124 - - UNI5148 - - UNI6252 - - UNI158

13 - - UNI36409 - - UNI36874 - TTGGTTGTGAGAAAAGGGTGCCAGCAATGCCTGGATCGCCTGTGGAAGTGAAGATACAGTCAAGATCCT

CACCTCCCATCATGCCACCCCTCCCACCAATAAATCCTGGAGGACCGAGGCCAGTGTCCTTTACTCCTACAGCAT - UNI6550 - - UNI15813 -

 - UNI21125 - TAAGCAATGGCATCAACCATTCCCCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCC

ACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTACTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCA

ATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGACTCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTC

AACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAGGAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI18817 - -

 UNI22506 - GCCAACCTGCCCCTGCTGCAGCGAGAACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCATGAGC

ACCTTCTGCTCAACACCAGTATCGCATCTCCTGCTGACTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG - UNI

9418 - - UNI9466 - GAGGGACGAGAATAATTTTGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCTGCTCC

TCGGCACAGTCCCGCCCTCACTGTTCCCCTTATGAATCCTGGGGGCCAGTTCCATCCTACTCCACCACCTCTTCAGCACTATACACTAGAAGACATTGCA

ACTTCTCACCTGTATCGGGAACCAAACAAGATGCTAGAACACCGAGAAGTTCGTGAGAGGCACCACAATCTTA - UNI9418 - GTCTCAATGGAGGC

TATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAAGGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCATTATGGAAATGGTA

GAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCTGTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAATGAAAATACAGAGT

TGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCACAGCCCTGGGAGTACAGATTCTCTCAGCAACG ATTCTCAGCGGGAATTTACCAGTAGACCAG

CAACAGGATATGTGCCTGTGGAGTTTTGGAAGAAAACAG - UNI598 - - UNI33366 - AAGCCGTGAATAAGGTGAAAATTCAGGCCATGTCAG

AGGTACAGAAGGCTGTAGCTGAGGCAGAGCAAAAAGCCTTTGAAGTGATTGCAACGGAGAGAGCTCGAATGGAGCAGACCATAGCGGATGTCAAACGGCA

GGCTGCAGAAGATGCTTTCCTGGTCATCAATGAGCAAGAAGAGTCCACAGAG - UNI598 - - UNI22223 - AACTGCTGGAACTGTGGCCGAAA

AGCCAGTGAGACGTGCAGTGGCTGCAACATTGCTCGCTACTGCGGCTCCTTCTGCCAGCATAAGGACTGGGAGCGGCACCACCGCCTCTGTGGCCAGAGT

CTACATGGCCACAGTCCCCACAGCCAGAGCAGGCCACTGCTCCCTGGAGGGCGGGGCTCAGCCAGGTCTGCTGACTGCAGTGTGCCCAGCCCAGCCCTGG

ACAAGACCTCAGCTACCACCTCACGGTCCTCAACACCTGCCTCTGTGACAGCCATTGATGCCAACGGGCTCTAAGCTACAGACTCCACCTGTCCTGATGA

CCCCTCCACATGGGAGCATGCTTGCACCAGTGAGCTGGCTATTAGAACAAGTAGCTGTTGGGTCGTCAGCAAGAAGTGAAGTTGGCAGGAAGCATCCAAG

AGGCACTCCACAGCTTCTCTGGGATTTGCCACGTGTCCTTGGAAGAACTAATGTATCATTCTCTGCACACAGGAAGTAGCTTGAGCTGCCTCCTCCATGG

CTTTCCTGAGGTTCCTCTTCCAGCTAAAGCTGGCATAACCAGCCCCTTCTCAGTGTATACACCAGCTCCCTCCGACTCCTTGCATTAGCATATTGTCAAT

AGTGTCCCACACTGTCCACAGTAGAGGCCTGAAGACTGGTAGCAGGCTTAGGAGGAGGCCCTTCCTTCCCCTGTCTTCAAACAGTTCCTTGAGCCCCATA

TCCACCCTCGAGTGACACTGATTGGCCTAAAAGAGACTTGGATAGCACAAAAGCAGTACTCAGGACTCTCTCCTGAGCTGCTCAGAGCTGTTAAGATGCT

CAGAAATGCAAGAAAGAAGTCACTGTTTCAGTAAAATCTCTAGTAATGATAAAAAATTAAATTAGTCTTCCCAAGCATCATGGATCATTTTGGACAAGAT

TTTCTAACTTGGCTGTCTTCGTTAGTTTGGAACCCACCTCTTAACTCCAGTGTTTTTCTTGATTTTGCTTGTGTAAAAAATAATCTCCATCGCATGGATC

GGTCTGAGAGAGGATGGAGCCATTGTGCTAGTCTTTTCTCTAAGCATGTTGGCCAAACTAAAATATTCCGTGGATCACCTTGGAAATGCAGAGCCTCTGC

CACTGCTTGACTGTTTAAAACAGTCGCCTTGTTGTATGTGTCCTTCTCTCTGGGACTGCATGTCTGGATCCTTGGGGATGTCTTGTGAGTAGGTTCTGTT

TGGCACCTAAGCAGTGCTCCTAACCCTGATGGGATTATTCGCACCTGGTTTTGACACCACCTCATAGGTTTATTATCAGGTGGACATTTGAGGCATCCTT

TTTCTGTGCTCCGTGTTTATAGTCTCCCTCACAGCTCAGAGTTTGTGAAGAATGGGAACCGTTTTTGAAGAGCCTGACCTGTTTTTTTTTTTTTTTTTTT

TTTTTCCCATCTTCAGGAACTTTTCCAATTATCTGATTCTCCAAATAGAATTTGGAGACATCGATCTGGTCATTATTGGACCTATTGATCAGGCCAAGTA

CTGCTCACATCTTTTCCTTGCCATCTAAAGTTTATTAGTTGTCAGCACCTTGCATCGGCCACTCAGTATACTCCAGAATCGTTTTGCCCTGTGCAGTCAA

TTGGGATAAGTCATTGCCTTTGATCCTGTTGGCTTTTGGAAGCTGTGGTCACTTTTTGTACAATGAACAAGTCTGAAGAACAAGTCTGAATACTAACACT

TGCCCCATAAAAGTATGGATTTAGTGTCTTTGCACACAGTTAAGGCTGATTTAAAAATACTGAGTTCCTATCTCATTGGAACAAGGGTTCTCAGACTTAG

AAAGTAGACCTTTAAAATCATGTTATTTTAGCATAGAATACCCAAGACCCACTGTTTGCCAGACAGCTTAGTACAGCCTGGCCTCCCTGGTCCCATCCCA

TCAGTCTAGTGGGGACAACTTTGACTTACTAGATAGAGTTAGTACCAGACAGCACTTGTCCATACTCAGACACAAAACTTCGGGCAGATCAGGAGCTTCT

GTGAACATGAGAATGTCTCCTGGTGTGCCCTGGTCAGTTACTCAGTAGTAAAATGGATGAACACCCTTTAAGTGTTAAATTTTTTTGCCACAGAACTACT

CCAGATAGTTGGAATAAAGAGCTAGAACCAATACATTACTACTTACCTGGTTGGAGATCAGTTTGTACAGCAAACTGGGTTACAAAATCTAGCCTACCTT

TGTGGGCTGTGTGATTGGCCTGTCCGATTCTGAGTTTCTATAGTGCTGTTGGGGACTGCTTTGCTTCTGTGTCCTACCCAGGTTTGTCTACACACTCGGA

CAGTACTTTACACTATATAGTTCAGTTCTCAGACTTGTCTCTATCTTGCCTCTGGTCAGCATCACTCTCGGGGTTTTGTTTTTGGTTTGGTTTGGTTTGG

TTTGGTTTGGTTTGGTTTGGTTTTTCGAGACAGGGTTTCTCCGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCGGACTGGCCTTGAACTCAGA

AATCCGCCTGCCTCTGCCTCCCAAGTGCTGAGATTAAAGGCATGCACTACCATGGCCCGGCTTCAGCATCACTCTTACGTGACATCTGTTTAGGACTTTT

CAGATTTAAGGAGTTCCTTTCTGCAGTTCTCCAACTCCTCCCTAGGCAGGAGCAGCAGCAGTAGGAGCTGGAGCTACAAGTGATTCCTGGCTCACCGCTT

TGTTTCTAAGTCTGCTTATATGAGCCACCAGGCTGGGAGTGAACATAGAGCTTCAGGCTGCTCACAAGTCTGGCCTCTGCAGTAACTATTTGAGGAAGAA

AAGTAGTCAGGGCTTGGTCATTCTGTACCAAGTGAGGGATAAAATTTCAGGAAGTAAATAACAAAAGTAGCCAAACTGGGAGTTCTGCACACCAGTCCTC

GCTCCAGCAAATGAAGACTTGTTGAAGCTAGCTTGGGACATGGCTTATTTGGTAGCATGGACTTCATTCCCAGTGTGGCATACACCAGCCATGGTGGCAC

ATACCTGTAATCCTCTAACACTTAGGAGGTAGAAGCAGGAGGACCAGAAGTTTAAGGTTATCCATAGCTGCATAGCAAGCCTGAGTTACAGGAGACTTAT

CCCACAGAGACTCATTGAAGGGCCCTGCAGCTTCAGATTGGCTCATGCAGGGAGGTGGAGGTGAGGGCGCAGGCTGTGAGTGGCTTTCTCCTAAGGTGCT

AAGTTATGTGCAGCCATGGGTCTCCATGGAATAACCTGTCTGGCCCCCCGAGGTCTATCCAGGCATTGGCTGTCAGTCTTCTGTAATGTAGACTCCTTTA

CCCATTTGATCCCCAGGGAGTGCTTCAAATCTTGATGTCAGCTTTACCGTCATTTCTTGTCACCTTCTCAGAGAGAGTGAAGACATTTTTTTCTGAGTGG

TTCTGGAAACTATCTCAGCAGGTGTGTGAGGCCTCAACACAACTGCAAGTGTGTGTTAGTGGTTCTCCCTAGAGCATAAGGAGTGAGCAGATGGCCTTCG

TTCTGAAAACTGCAGACAGGATTGTGGGTTGAATAAACCTTTACAAATAGGACACGTCTTGGAGGCTTACTTCAGAACTGGACTGGAACCAAGGTTTCCA

GGCTCCTGGCTCAGGAGACTAAGCCAGTGTACTTTGATGAATGTTAGCTATTTGCAGAGAACTGGGTGGTGGCATGTTTGAACCAAATGTGAGAAAAGCC

AGAAGGAACTGAACTGGCCATTGTGGACCAGATGGCCAGCTGTGGAAGATCCTTGATCCAGCAGCTGCTTAGCAGACCCTGGCCACTCAAGTATATTCCT

TTAAAGCCAAAATGCTGACTACCTGCTTCTGCCTCATGTTGACACCCATTTCCAAAGATGATGGAGCCAGTGTGAGCCAGGAGGAAGCTGAGATGGTGGC

TGATAATTTACTCTACCATCTCCTTCCACAGCCCAAGAGGTGGCACTTCCCGCTCAGACACCGTCTTATCAGGCCTCCAGCTGCCCAGTGTAAACTGTCA

ATGCTTATACCAAAAAGGGCATGTGCAGCTGGTGTCTGCCAGGGACAGCCCAGTCCCTGCCTTGTGGTTCCCAGGAAGAAGCTGCAACAATTCAGTGAAT

GATTAAAGGGCTGTTTGATAATAAGGCCTTCGTTCCACTCCTGTGGCTTTCCAAGTTCCTAATGAGGCTACAAAGGCTCCATCCATACAGAAAACCAATA

ATGTAAATAAAAGCCAATCCTGCAAGCATGGTTTGCAGAGGCGGGTGATGAATGTGAAGCCACCCGCAGGATGCATTTGAGTCTGGTTTTTCTGTGCTTT

GTCATTTGACTCAGTAGGAACTTTTGTTACTTAACTCTGTGCATAACTTATTTAATGTACTGTATAAATGAACCAAAACTGTTAAATATGTATTTAGTTT

GTTCTACTTAAAGTAGTTAATAAAAATGCTATATTCCTTTTCTGACTCAA
Translation
MVGVPGAAAFQL - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - LGCEKRVPAMPGS

PVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTAL - UNI6550 - - UNI15813 - - UNI21125 - LSNGINHSPPTLNGAPSPPQRFSNG

PASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALV - UNI8574 - - UNI21125 - - UNI22506 - NSTVT

IEEFHCKLQEATNFPLRPFVIPFLK - UNI18817 - - UNI22506 - ANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLM

EVHGNGKRPSPER - UNI9418 - - UNI9466 - RRDENNFERDTVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIAT

SHLYREPNKMLEHREVRERHHNLS - UNI9418 - SLNGGYQDELVDHRLTEREWADEWKHLDH ALNCIMEMVEKTRRSMAVLRRCQESDREELNYW

KRRFNENTELRKTGTELVSRQHSPGSTDSLSND DSQREFTSRPATGYVPVEFWKKTE - UNI598 - - UNI33366 - EAVNKVKIQAMSEVQKA

VAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQEESTE - UNI598 - - UNI22223 - NCWNCGRKASETCSGCNIARYCGSFCQHK

DWERHHRLCGQSLHGHSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL
Transcript ENSMUST00000099178
Sequence
GCGGGTGCAGGTCCCGGCCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGCTCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCT

GGAGCGGCCGCCTTCCAAC - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - TTGGTT

GTGAGAAAAGGGTGCCAGCAATGCCTGGATCGCCTGTGGAAGTGAAGATACAGTCAAGATCCTCACCTCCCATCATGCCACCCCTCCCACCAATAAATCC

TGGAGGACCGAGGCCAGTGTCCTTTACTCCTACAGCAT - UNI6550 - - UNI15813 - - UNI21125 - TAAGCAATGGCATCAACCATTCC

CCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCCACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTA

CTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCAATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGAC

TCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTCAACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAG

GAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI18817 - - UNI22506 - GCCAACCTGCCCCTGCTGCAGCGAG

AACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCATGAGCACCTTCTGCTCAACACCAGTATCGCATCTCCTGCTGA

CTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG - UNI9418 - - UNI9466 - GAGGGACGAGAATAATTT

TGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCTGCTCCTCGGCACAGTCCCGCCCTCACTGTTCCCCTTATGAAT

CCTGGGGGCCAGTTCCATCCTACTCCACCACCTCTTCAGCACTATACACTAGAAGACATTGCAACTTCTCACCTGTATCGGGAACCAAACAAGATGCTAG

AACACCGAGAAGTTCGTGAGAGGCACCACAATCTTA - UNI9418 - GTCTCAATGGAGGCTATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAA

GGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCATTATGGAAATGGTAGAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCT

GTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAATGAAAATACAGAGTTGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCA

CAGCCCTGGGAGTACAGATTCTCTCAGCAACG GTTTGCTGACACTGCTCACAGGCTCAGGGAAGCAAGCTTATGTGTTTAAAAAGGATACACATGAAGA

GATGCAAAACACACGGTCTGGGACACAGGACTTCTCTAGACTTGCCACACTGAAGAATTGTACATTTCTGCTAACCAGCTTTCTGGATCCTCCATCTTAT

GGCTGTGTCCTTGCAGTTGAATTATAA
Translation
MVGVPGAAAFQL - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - LGCEKRVPAMPGS

PVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTAL - UNI6550 - - UNI15813 - - UNI21125 - LSNGINHSPPTLNGAPSPPQRFSNG

PASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALV - UNI8574 - - UNI21125 - - UNI22506 - NSTVT

IEEFHCKLQEATNFPLRPFVIPFLK - UNI18817 - - UNI22506 - ANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLM

EVHGNGKRPSPER - UNI9418 - - UNI9466 - RRDENNFERDTVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIAT

SHLYREPNKMLEHREVRERHHNLS - UNI9418 - SLNGGYQDELVDHRLTEREWADEWKHLDH ALNCIMEMVEKTRRSMAVLRRCQESDREELNYW

KRRFNENTELRKTGTELVSRQHSPGSTDSLSNG GLLTLLTGSGKQAYVFKKDTHEEMQNTRSGTQDFSRLATLKNCTFLLTSFLDPPSYGCVLAVEL
Transcript ENSMUST00000109724
Sequence
CCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGCTCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCTGGAGCGGCCGCCTTCCA

AC - UNI124 - - UNI5148 - - UNI6252 - - UNI6550 - - UNI15813 - - UNI21125 - - UNI36409 - - UNI36874 

- TAAGCAATGGCATCAACCATTCCCCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCCACATCGTCAGCA

CTAACGAATCAACAGCTGCCGGCTACTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCAATGATATCTCAC

CTGAGATCGGCGAGAAGGTTCGGACTCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTCAACAGTAACAAT

TGAAGAATTCCATTGCAAGCTCCAGGAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI18817 - - UNI22506 - 

GCCAACCTGCCCCTGCTGCAGCGAGAACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCATGAGCACCTTCTGCTCA

ACACCAGTATCGCATCTCCTGCTGACTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG - UNI9418 - - UNI

9466 - GAGGGACGAGAATAATTTTGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCTGCTCCTCGGCACAGTCC

CGCCCTCACTGTTCCCCTTATGA
Translation
MVGVPGAAAFQL - UNI124 - - UNI5148 - - UNI6252 - - UNI6550 - - UNI15813 - - UNI21125 - - UNI36409 - -

 UNI36874 - LSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALV - UNI8

574 - - UNI21125 - - UNI22506 - NSTVTIEEFHCKLQEATNFPLRPFVIPFLK - UNI18817 - - UNI22506 - ANLPLLQRELL

HCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPER - UNI9418 - - UNI9466 - RRDENNFERDTVPPEPPAKRVCTIS

PAPRHSPALTVPLM
Transcript ENSMUST00000109720
Sequence
GCGGGTGCAGGTCCCGGCCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGCTCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCT

GGAGCGGCCGCCTTCCAAC - UNI124 - - UNI5148 - - UNI6252 - - UNI6550 - - UNI15813 - - UNI21125 - - UNI36

409 - - UNI36874 - TAAGCAATGGCATCAACCATTCCCCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCT

CCTCCACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTACTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTT

TGGCAATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGACTCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - 

AACTCAACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAGGAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI1881

7 - - UNI22506 - GCCAACCTGCCCCTGCTGCAGCGAGAACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCA

TGAGCACCTTCTGCTCAACACCAGTATCGCATCTCCTGCTGACTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG 

- UNI9418 - - UNI9466 - GAGGGACGAGAATAATTTTGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCT

GCTCCTCGGCACAGTCCCGCCCTCACTGTTCCCCTTATGAATCCTGGGGGCCAGTTCCATCCTACTCCACCACCTCTTCAGCACTATACACTAGAAGACA

TTGCAACTTCTCACCTGTATCGGGAACCAAACAAGATGCTAGAACACCGAGAAGTTCGTGAGAGGCACCACAATCTTA - UNI9418 - GTCTCAATG

GAGGCTATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAAGGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCATTATGGAAA

TGGTAGAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCTGTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAATGAAAATAC

AGAGTTGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCACAGCCCTGGGAGTACAGATTCTCTCAGCAACG ATTCTCAGCGGGAATTTACCAGTAG

ACCAGCAACAGGATATGTGCCTGTGGAGTTTTGGAAGAAAACAG - UNI33366 - AAGAAGCCGTGAATAAGGTGAAAATTCAGGCCATGTCAGAGG

TACAGAAGGCTGTAGCTGAGGCAGAGCAAAAAGCCTTTGAAGTGATTGCAACGGAGAGAGCTCGAATGGAGCAGACCATAGCGGATGTCAAACGGCAGGC

TGCAGAAGATGCTTTCCTGGTCATCAATGAGCAAGAAGAGTCCACAGAG - UNI598 - - UNI22223 - AACTGCTGGAACTGTGGCCGAAAAGC

CAGTGAGACGTGCAGTGGCTGCAACATTGCTCGCTACTGCGGCTCCTTCTGCCAGCATAAGGACTGGGAGCGGCACCACCGCCTCTGTGGCCAGAGTCTA

CATGGCCACAGTCCCCACAGCCAGAGCAGGCCACTGCTCCCTGGAGGGCGGGGCTCAGCCAGGTCTGCTGACTGCAGTGTGCCCAGCCCAGCCCTGGACA

AGACCTCAGCTACCACCTCACGGTCCTCAACACCTGCCTCTGTGACAGCCATTGATGCCAACGGGCTCTAAGCTACAGACTCCACCTGTCCTGATGACCC

CTCCACATGGGAGCATGCTTGCACCAGTGAGCTGGCTATTAGAACAAGTAGCTGTTGGGTCGTCAGCAAGAAGTGAAGTTGGCAGGAAGCATCCAAGAGG

CACTCCACAGCTTCTCTGGGATTTGCCACGTGTCCTTGGAAGAACTAATGTATCATTCTCTGCACACAGGAAGTAGCTTGAGCTGCCTCCTCCATGGCTT

TCCTGAGGTTCCTCTTCCAGCTAAAGCTGGCATAACCAGCCCCTTCTCAGTGTATACACCAGCTCCCTCCGACTCCTTGCATTAGCATATTGTCAATAGT

GTCCCACACTGTCCACAGTAGAGGCCTGAAGACTGGTAGCAGGCTTAGGAGGAGGCCCTTCCTTCCCCTGTCTTCAAACAGTTCCTTGAGCCCCATATCC

ACCCTCGAGTGACACTGATTGGCCTAAAAGAGACTTGGATAGCACAAAAGCAGTACTCAGGACTCTCTCCTGAGCTGCTCAGAGCTGTTAAGATGCTCAG

AAATGCAAGAAAGAAGTCACTGTTTCAGTAAAATCTCTAGTAATGATAAAAAATTAAATTAGTCTTCCCAAGCATCATGGATCATTTTGGACAAGATTTT

CTAACTTGGCTGTCTTCGTTAGTTTGGAACCCACCTCTTAACTCCAGTGTTTTTCTTGATTTTGCTTGTGTAAAAAATAATCTCCATCGCATGGATCGGT

CTGAGAGAGGATGGAGCCATTGTGCTAGTCTTTTCTCTAAGCATGTTGGCCAAACTAAAATATTCCGTGGATCACCTTGGAAATGCAGAGCCTCTGCCAC

TGCTTGACTGTTTAAAACAGTCGCCTTGTTGTATGTGTCCTTCTCTCTGGGACTGCATGTCTGGATCCTTGGGGATGTCTTGTGAGTAGGTTCTGTTTGG

CACCTAAGCAGTGCTCCTAACCCTGATGGGATTATTCGCACCTGGTTTTGACACCACCTCATAGGTTTATTATCAGGTGGACATTTGAGGCATCCTTTTT

CTGTGCTCCGTGTTTATAGTCTCCCTCACAGCTCAGAGTTTGTGAAGAATGGGAACCGTTTTTGAAGAGCCTGACCTGTTTTTTTTTTTTTTTTTTTTTT

TTCCCATCTTCAGGAACTTTTCCAATTATCTGATTCTCCAAATAGAATTTGGAGACATCGATCTGGTCATTATTGGACCTATTGATCAGGCCAAGTACTG

CTCACATCTTTTCCTTGCCATCTAAAGTTTATTAGTTGTCAGCACCTTGCATCGGCCACTCAGTATACTCCAGAATCGTTTTGCCCTGTGCAGTCAATTG

GGATAAGTCATTGCCTTTGATCCTGTTGGCTTTTGGAAGCTGTGGTCACTTTTTGTACAATGAACAAGTCTGAAGAACAAGTCTGAATACTAACACTTGC

CCCATAAAAGTATGGATTTAGTGTCTTTGCACACAGTTAAGGCTGATTTAAAAATACTGAGTTCCTATCTCATTGGAACAAGGGTTCTCAGACTTAGAAA

GTAGACCTTTAAAATCATGTTATTTTAGCATAGAATACCCAAGACCCACTGTTTGCCAGACAGCTTAGTACAGCCTGGCCTCCCTGGTCCCATCCCATCA

GTCTAGTGGGGACAACTTTGACTTACTAGATAGAGTTAGTACCAGACAGCACTTGTCCATACTCAGACACAAAACTTCGGGCAGATCAGGAGCTTCTGTG

AACATGAGAATGTCTCCTGGTGTGCCCTGGTCAGTTACTCAGTAGTAAAATGGATGAACACCCTTTAAGTGTTAAATTTTTTTGCCACAGAACTACTCCA

GATAGTTGGAATAAAGAGCTAGAACCAATACATTACTACTTACCTGGTTGGAGATCAGTTTGTACAGCAAACTGGGTTACAAAATCTAGCCTACCTTTGT

GGGCTGTGTGATTGGCCTGTCCGATTCTGAGTTTCTATAGTGCTGTTGGGGACTGCTTTGCTTCTGTGTCCTACCCAGGTTTGTCTACACACTCGGACAG

TACTTTACACTATATAGTTCAGTTCTCAGACTTGTCTCTATCTTGCCTCTGGTCAGCATCACTCTCGGGGTTTTGTTTTTGGTTTGGTTTGGTTTGGTTT

GGTTTGGTTTGGTTTGGTTTTTCGAGACAGGGTTTCTCCGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCGGACTGGCCTTGAACTCAGAAAT

CCGCCTGCCTCTGCCTCCCAAGTGCTGAGATTAAAGGCATGCACTACCATGGCCCGGCTTCAGCATCACTCTTACGTGACATCTGTTTAGGACTTTTCAG

ATTTAAGGAGTTCCTTTCTGCAGTTCTCCAACTCCTCCCTAGGCAGGAGCAGCAGCAGTAGGAGCTGGAGCTACAAGTGATTCCTGGCTCACCGCTTTGT

TTCTAAGTCTGCTTATATGAGCCACCAGGCTGGGAGTGAACATAGAGCTTCAGGCTGCTCACAAGTCTGGCCTCTGCAGTAACTATTTGAGGAAGAAAAG

TAGTCAGGGCTTGGTCATTCTGTACCAAGTGAGGGATAAAATTTCAGGAAGTAAATAACAAAAGTAGCCAAACTGGGAGTTCTGCACACCAGTCCTCGCT

CCAGCAAATGAAGACTTGTTGAAGCTAGCTTGGGACATGGCTTATTTGGTAGCATGGACTTCATTCCCAGTGTGGCATACACCAGCCATGGTGGCACATA

CCTGTAATCCTCTAACACTTAGGAGGTAGAAGCAGGAGGACCAGAAGTTTAAGGTTATCCATAGCTGCATAGCAAGCCTGAGTTACAGGAGACTTATCCC

ACAGAGACTCATTGAAGGGCCCTGCAGCTTCAGATTGGCTCATGCAGGGAGGTGGAGGTGAGGGCGCAGGCTGTGAGTGGCTTTCTCCTAAGGTGCTAAG

TTATGTGCAGCCATGGGTCTCCATGGAATAACCTGTCTGGCCCCCCGAGGTCTATCCAGGCATTGGCTGTCAGTCTTCTGTAATGTAGACTCCTTTACCC

ATTTGATCCCCAGGGAGTGCTTCAAATCTTGATGTCAGCTTTACCGTCATTTCTTGTCACCTTCTCAGAGAGAGTGAAGACATTTTTTTCTGAGTGGTTC

TGGAAACTATCTCAGCAGGTGTGTGAGGCCTCAACACAACTGCAAGTGTGTGTTAGTGGTTCTCCCTAGAGCATAAGGAGTGAGCAGATGGCCTTCGTTC

TGAAAACTGCAGACAGGATTGTGGGTTGAATAAACCTTTACAAATAGGACACGTCTTGGAGGCTTACTTCAGAACTGGACTGGAACCAAGGTTTCCAGGC

TCCTGGCTCAGGAGACTAAGCCAGTGTACTTTGATGAATGTTAGCTATTTGCAGAGAACTGGGTGGTGGCATGTTTGAACCAAATGTGAGAAAAGCCAGA

AGGAACTGAACTGGCCATTGTGGACCAGATGGCCAGCTGTGGAAGATCCTTGATCCAGCAGCTGCTTAGCAGACCCTGGCCACTCAAGTATATTCCTTTA

AAGCCAAAATGCTGACTACCTGCTTCTGCCTCATGTTGACACCCATTTCCAAAGATGATGGAGCCAGTGTGAGCCAGGAGGAAGCTGAGATGGTGGCTGA

TAATTTACTCTACCATCTCCTTCCACAGCCCAAGAGGTGGCACTTCCCGCTCAGACACCGTCTTATCAGGCCTCCAGCTGCCCAGTGTAAACTGTCAATG

CTTATACCAAAAAGGGCATGTGCAGCTGGTGTCTGCCAGGGACAGCCCAGTCCCTGCCTTGTGGTTCCCAGGAAGAAGCTGCAACAATTCAGTGAATGAT

TAAAGGGCTGTTTGATAATAAGGCCTTCGTTCCACTCCTGTGGCTTTCCAAGTTCCTAATGAGGCTACAAAGGCTCCATCCATACAGAAAACCAATAATG

TAAATAAAAGCCAATCCTGCAAGCATGGTTTGCAGAGGCGGGTGATGAATGTGAAGCCACCCGCAGGATGCATTTGAGTCTGGTTTTTCTGTGCTTTGTC

ATTTGACTCAGTAGGAACTTTTGTTACTTAACTCTGTGCATAACTTATTTAATGTACTGTATAAATGAACCAAAACTGTTAAATATGTATTTAGTTTGTT

CTACTTAAAGTAGTTAATAAAAATGCTATATTCCTTTTCTGACTC
Translation
MVGVPGAAAFQL - UNI124 - - UNI5148 - - UNI6252 - - UNI6550 - - UNI15813 - - UNI21125 - - UNI36409 - -

 UNI36874 - LSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALV - UNI8

574 - - UNI21125 - - UNI22506 - NSTVTIEEFHCKLQEATNFPLRPFVIPFLK - UNI18817 - - UNI22506 - ANLPLLQRELL

HCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPER - UNI9418 - - UNI9466 - RRDENNFERDTVPPEPPAKRVCTIS

PAPRHSPALTVPLM - UNI9418 -    - UNI33366 -  - UNI598 - - UNI22223 - 
Transcript ENSMUST00000109718
Sequence
CTCCGGGTGCTGAGCAGGACTGTGTGGAGCGGCCTTGGAGCTCAGGCCTGGCGGGCGCCCTATGGACTGTCCGCGAGAGAAGTATTGTTTTGTTTTCGCG

GCATCGGGGCTGAAAGTCCGGTCCCGGGAAACACGCCGGAATTGGAGCGACGAGTGGTAGATGTTGGAGGATGCCGGGCTGATATTCCGGAGGGCCCTGT

TGAAT - UNI6252 - - UNI15813 - TTGGTTGTGAGAAAAGGGTGCCAGCAATGCCTGGATCGCCTGTGGAAGTGAAGATACAGTCAAGATCCT

CACCTCCCATCATGCCACCCCTCCCACCAATAAATCCTGGAGGACCGAGGCCAGTGTCCTTTACTCCTACAGCAT - UNI6550 - - UNI15813 -

 - UNI21125 - TAAGCAATGGCATCAACCATTCCCCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCC

ACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTACTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCA

ATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGACTCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTC

AACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAGGAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI18817 - -

 UNI22506 - GCCAACCTGCCCCTGCTGCAGCGAGAACTGCTGCACTGTGCCCGGGCTGCCAAGCAGACCCCGTCCCAGTACCTGGCCCAGCATGAGC

ACCTTCTGCTCAACACCAGTATCGCATCTCCTGCTGACTCTTCTGAACTGCTCATGGAGGTTCATGGAAATGGAAAGAGGCCCAGTCCGGAAAG - UNI

9418 - - UNI9466 - GAGGGACGAGAATAATTTTGAAAGAGATACAGTTCCTCCTGAACCGCCTGCCAAGAGAGTGTGTACTATCAGCCCTGCTCC

TCGGCACAGTCCCGCCCTCACTGTTCCCCTTATGAATCCTGGGGGCCAGTTCCATCCTACTCCACCACCTCTTCAGCACTATACACTAGAAGACATTGCA

ACTTCTCACCTGTATCGGGAACCAAACAAGATGCTAGAACACCGAGAAGTTCGTGAGAGGCACCACAATCTTA - UNI9418 - GTCTCAATGGAGGC

TATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAAGGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCATTATGGAAATGGTA

GAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCTGTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAATGAAAATACAGAGT

TGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCACAGCCCTGGGAGTACAGATTCTCTCAGCAACG ATTCTCAGCGGGAATTTACCAGTAGACCAG

CAACAGGATATGTGCCTGTGGAGTTTTGGAAGAAAACAG - UNI598 - - UNI33366 - AAGCCGTGAATAAGGTGAAAATTCAGGCCATGTCAG

AGGTACAGAAGGCTGTAGCTGAGGCAGAGCAAAAAGCCTTTGAAGTGATTGCAACGGAGAGAGCTCGAATGGAGCAGACCATAGCGGATGTCAAACGGCA

GGCTGCAGAAGATGCTTTCCTGGTCATCAATGAGCAAGAAGAGTCCACAGAG - UNI598 - - UNI22223 - AACTGCTGGAACTGTGGCCGAAA

AGCCAGTGAGACGTGCAGTGGCTGCAACATTGCTCGCTACTGCGGCTCCTTCTGCCAGCATAAGGACTGGGAGCGGCACCACCGCCTCTGTGGCCAGAGT

CTACATGGCCACAGTCCCCACAGCCAGAGCAGGCCACTGCTCCCTGGAGGGCGGGGCTCAGCCAGGTCTGCTGACTGCAGTGTGCCCAGCCCAGCCCTGG

ACAAGACCTCAGCTACCACCTCACGGTCCTCAACACCTGCCTCTGTGACAGCCATTGATGCCAACGGGCTCTAAGCTACAGACTCCACCTGTCCTGATGA

CCCCTCCACATGGGAGCATGCTTGCACCAGTGAGCTGGCTATTAGAACAAGTAGCTGTTGGGTCGTCAGCAAGAAGTGAAGTTGGCAGGAAGCATCCAAG

AGGCACTCCACAGCTTCTCTGGGATTTGCCACGTGTCCTTGGAAGAACTAATGTATCATTCTCTGCACACAGGAAGTAGCTTGAGCTGCCTCCTCCATGG

CTTTCCTGAGGTTCCTCTTCCAGCTAAAGCTGGCATAACCAGCCCCTTCTCAGTGTATACACCAGCTCCCTCCGACTCCTTGCATTAGCATATTGTCAAT

AGTGTCCCACACTGTCCACAGTAGAGGCCTGAAGACTGGTAGCAGGCTTAGGAGGAGGCCCTTCCTTCCCCTGTCTTCAAACAGTTCCTTGAGCCCCATA

TCCACCCTCGAGTGACACTGATTGGCCTAAAAGAGACTTGGATAGCACAAAAGCAGTACTCAGGACTCTCTCCTGAGCTGCTCAGAGCTGTTAAGATGCT

CAGAAATGCAAGAAAGAAGTCACTGTTTCAGTAAAATCTCTAGTAATG
Translation
LRVLSRTVWSGLGAQAWRAPYGLSAREVLFCFRGIGAESPVPGNTPELERRVVDVGGCRADIPEGPVEF - UNI6252 - - UNI15813 - FGCEK

RVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTAL - UNI6550 - - UNI15813 - - UNI21125 - LSNGINHSPPTLNGAPS

PPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRT - UNI8574 - - UNI21125 - - UNI22506 -  - 

UNI18817 - - UNI22506 -  - UNI9418 - - UNI9466 -  - UNI9418 -    - UNI598 - - UNI33366 -  - UNI598 -

 - UNI22223 - 
Transcript ENSMUST00000109717
Sequence
GCGGGTGCAGGTCCCGGCCTGCGCCTGCGGAGGGCTCAGGCAGAGGGTCGAAGCGAGCGGCGCTCGCGACAGACTGCGCTCCGCGATGGTGGGCGTCCCT

GGAGCGGCCGCCTTCCAAC - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 - TTGGTT

GTGAGAAAAGGGTGCCAGCAATGCCTGGATCGCCTGTGGAAGTGAAGATACAGTCAAGATCCTCACCTCCCATCATGCCACCCCTCCCACCAATAAATCC

TGGAGGACCGAGGCCAGTGTCCTTTACTCCTACAGCAT - UNI6550 - - UNI15813 - - UNI21125 - TAAGCAATGGCATCAACCATTCC

CCTCCTACCCTGAATGGTGCCCCATCGCCACCACAGAGATTCAGCAATGGGCCTGCCTCCTCCACATCGTCAGCACTAACGAATCAACAGCTGCCGGCTA

CTTGTGGTGCTCGGCAGCTCAGCAAGTTGAAACGCTTCCTCACCACTCTGCAGCAGTTTGGCAATGATATCTCACCTGAGATCGGCGAGAAGGTTCGGAC

TCTCGTTCTAGCCTTGGTG - UNI8574 - - UNI21125 - - UNI22506 - AACTCAACAGTAACAATTGAAGAATTCCATTGCAAGCTCCAG

GAGGCCACAAACTTTCCTCTTCGTCCATTTGTGATTCCATTTCTCAAG - UNI9418 - - UNI9466 - - UNI18817 - - UNI22506 - G

TCTCAATGGAGGCTATCAAGATGAGTTGGTAGACCACCGTTTGACAGAAAGGGAGTGGGCTGATGAATGGAAACACCTTGACCAT GCACTGAATTGCAT

TATGGAAATGGTAGAGAAAACTAGGCGCTCCATGGCAGTTCTGAGGCGCTGTCAGGAATCTGACCGTGAAGAACTCAACTATTGGAAACGGCGGTTTAAT

GAAAATACAGAGTTGAGGAAAACTGGGACTGAGTTGGTCTCTAGGCAGCACAGCCCTGGGAGTACAGATTCTCTCAGCAACG ATTCTCAGCGGGAATTT

ACCAGTAGACCAGCAACAGGATATGTGCCTGTGGAGTTTTGGAAGAAAACAG - UNI598 - - UNI33366 - AAGCCGTGAATAAGGTGAAAATT

CAGGCCATGTCAGAGGTACAGAAGGCTGTAGCTGAGGCAGAGCAAAAAGCCTTTGAAGTGATTGCAACGGAGAGAGCTCGAATGGAGCAGACCATAGCGG

ATGTCAAACGGCAGGCTGCAGAAGATGCTTTCCTGGTCATCAATGAGCAAGAAGAGTCCACAGAG - UNI598 - - UNI22223 - AACTGCTGGA

ACTGTGGCCGAAAAGCCAGTGAGACGTGCAGTGGCTGCAACATTGCTCGCTACTGCGGCTCCTTCTGCCAGCATAAGGACTGGGAGCGGCACCACCGCCT

CTGTGGCCAGAGTCTACATGGCCACAGTCCCCACAGCCAGAGCAGGCCACTGCTCCCTGGAGGGCGGGGCTCAGCCAGGTCTGCTGACTGCAGTGTGCCC

AGCCCAGCCCTGGACAAGACCTCAGCTACCACCTCACGGTCCTCAACACCTGCCTCTGTGACAGCCATTGATGCCAACGGGCTCTAAGCTACAGACTCCA

CCTGTCCTGATGACCCCTCCACATGGGAGCATGCTTGCACCAGTGAGCTGGCTATTAGAACAAGTAGCTGTTGGGTCGTCAGCAAGAAGTGAAGTTGGCA

GGAAGCATCCAAGAGGCACTCCACAGCTTCTCTGGGATTTGCCACGTGTCCTTGGAAGAACTAATGTATCATTCTCTGCACACAGGAAGTAGCTTGAGCT

GCCTCCTCCATGGCTTTCCTGAGGTTCCTCTTCCAGCTAAAGCTGGCATAACCAGCCCCTTCTCAGTGTATACACCAGCTCCCTCCGACTCCTTGCATTA

GCATATTGTCAATAGTGTCCCACACTGTCCACAGTAGAGGCCTGAAGACTGGTAGCAGGCTTAGGAGGAGGCCCTTCCTTCCCCTGTCTTCAAACAGTTC

CTTGAGCCCCATATCCACCCTCGAGTGACACTGATTGGCCTAAAAGAGACTTGGATAGCACAAAAGCAGTACTCAGGACTCTCTCCTGAGCTGCTCAGAG

CTGTTAAGATGCTCAGAAATGCAAGAAAGAAGTCACTGTTTCAGTAAAATCTCTAGTAATGATAAAAAATTAAATTAGTCTTCCCAAGCATCATGGATCA

TTTTGGACAAGATTTTCTAACTTGGCTGTCTTCGTTAGTTTGGAACCCACCTCTTAACTCCAGTGTTTTTCTTGATTTTGCTTGTGTAAAAAATAATCTC

CATCGCATGGATCGGTCTGAGAGAGGATGGAGCCATTGTGCTAGTCTTTTCTCTAAGCATGTTGGCCAAACTAAAATATTCCGTGGATCACCTTGGAAAT

GCAGAGCCTCTGCCACTGCTTGACTGTTTAAAACAGTCGCCTTGTTGTATGTGTCCTTCTCTCTGGGACTGCATGTCTGGATCCTTGGGGATGTCTTGTG

AGTAGGTTCTGTTTGGCACCTAAGCAGTGCTCCTAACCCTGATGGGATTATTCGCACCTGGTTTTGACACCACCTCATAGGTTTATTATCAGGTGGACAT

TTGAGGCATCCTTTTTCTGTGCTCCGTGTTTATAGTCTCCCTCACAGCTCAGAGTTTGTGAAGAATGGGAACCGTTTTTGAAGAGCCTGACCTGTTTTTT

TTTTTTTTTTTTTTTTTTCCCATCTTCAGGAACTTTTCCAATTATCTGATTCTCCAAATAGAATTTGGAGACATCGATCTGGTCATTATTGGACCTATTG

ATCAGGCCAAGTACTGCTCACATCTTTTCCTTGCCATCTAAAGTTTATTAGTTGTCAGCACCTTGCATCGGCCACTCAGTATACTCCAGAATCGTTTTGC

CCTGTGCAGTCAATTGGGATAAGTCATTGCCTTTGATCCTGTTGGCTTTTGGAAGCTGTGGTCACTTTTTGTACAATGAACAAGTCTGAAGAACAAGTCT

GAATACTAACACTTGCCCCATAAAAGTATGGATTTAGTGTCTTTGCACACAGTTAAGGCTGATTTAAAAATACTGAGTTCCTATCTCATTGGAACAAGGG

TTCTCAGACTTAGAAAGTAGACCTTTAAAATCATGTTATTTTAGCATAGAATACCCAAGACCCACTGTTTGCCAGACAGCTTAGTACAGCCTGGCCTCCC

TGGTCCCATCCCATCAGTCTAGTGGGGACAACTTTGACTTACTAGATAGAGTTAGTACCAGACAGCACTTGTCCATACTCAGACACAAAACTTCGGGCAG

ATCAGGAGCTTCTGTGAACATGAGAATGTCTCCTGGTGTGCCCTGGTCAGTTACTCAGTAGTAAAATGGATGAACACCCTTTAAGTGTTAAATTTTTTTG

CCACAGAACTACTCCAGATAGTTGGAATAAAGAGCTAGAACCAATACATTACTACTTACCTGGTTGGAGATCAGTTTGTACAGCAAACTGGGTTACAAAA

TCTAGCCTACCTTTGTGGGCTGTGTGATTGGCCTGTCCGATTCTGAGTTTCTATAGTGCTGTTGGGGACTGCTTTGCTTCTGTGTCCTACCCAGGTTTGT

CTACACACTCGGACAGTACTTTACACTATATAGTTCAGTTCTCAGACTTGTCTCTATCTTGCCTCTGGTCAGCATCACTCTCGGGGTTTTGTTTTTGGTT

TGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTTTCGAGACAGGGTTTCTCCGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCGGACTGG

CCTTGAACTCAGAAATCCGCCTGCCTCTGCCTCCCAAGTGCTGAGATTAAAGGCATGCACTACCATGGCCCGGCTTCAGCATCACTCTTACGTGACATCT

GTTTAGGACTTTTCAGATTTAAGGAGTTCCTTTCTGCAGTTCTCCAACTCCTCCCTAGGCAGGAGCAGCAGCAGTAGGAGCTGGAGCTACAAGTGATTCC

TGGCTCACCGCTTTGTTTCTAAGTCTGCTTATATGAGCCACCAGGCTGGGAGTGAACATAGAGCTTCAGGCTGCTCACAAGTCTGGCCTCTGCAGTAACT

ATTTGAGGAAGAAAAGTAGTCAGGGCTTGGTCATTCTGTACCAAGTGAGGGATAAAATTTCAGGAAGTAAATAACAAAAGTAGCCAAACTGGGAGTTCTG

CACACCAGTCCTCGCTCCAGCAAATGAAGACTTGTTGAAGCTAGCTTGGGACATGGCTTATTTGGTAGCATGGACTTCATTCCCAGTGTGGCATACACCA

GCCATGGTGGCACATACCTGTAATCCTCTAACACTTAGGAGGTAGAAGCAGGAGGACCAGAAGTTTAAGGTTATCCATAGCTGCATAGCAAGCCTGAGTT

ACAGGAGACTTATCCCACAGAGACTCATTGAAGGGCCCTGCAGCTTCAGATTGGCTCATGCAGGGAGGTGGAGGTGAGGGCGCAGGCTGTGAGTGGCTTT

CTCCTAAGGTGCTAAGTTATGTGCAGCCATGGGTCTCCATGGAATAACCTGTCTGGCCCCCCGAGGTCTATCCAGGCATTGGCTGTCAGTCTTCTGTAAT

GTAGACTCCTTTACCCATTTGATCCCCAGGGAGTGCTTCAAATCTTGATGTCAGCTTTACCGTCATTTCTTGTCACCTTCTCAGAGAGAGTGAAGACATT

TTTTTCTGAGTGGTTCTGGAAACTATCTCAGCAGGTGTGTGAGGCCTCAACACAACTGCAAGTGTGTGTTAGTGGTTCTCCCTAGAGCATAAGGAGTGAG

CAGATGGCCTTCGTTCTGAAAACTGCAGACAGGATTGTGGGTTGAATAAACCTTTACAAATAGGACACGTCTTGGAGGCTTACTTCAGAACTGGACTGGA

ACCAAGGTTTCCAGGCTCCTGGCTCAGGAGACTAAGCCAGTGTACTTTGATGAATGTTAGCTATTTGCAGAGAACTGGGTGGTGGCATGTTTGAACCAAA

TGTGAGAAAAGCCAGAAGGAACTGAACTGGCCATTGTGGACCAGATGGCCAGCTGTGGAAGATCCTTGATCCAGCAGCTGCTTAGCAGACCCTGGCCACT

CAAGTATATTCCTTTAAAGCCAAAATGCTGACTACCTGCTTCTGCCTCATGTTGACACCCATTTCCAAAGATGATGGAGCCAGTGTGAGCCAGGAGGAAG

CTGAGATGGTGGCTGATAATTTACTCTACCATCTCCTTCCACAGCCCAAGAGGTGGCACTTCCCGCTCAGACACCGTCTTATCAGGCCTCCAGCTGCCCA

GTGTAAACTGTCAATGCTTATACCAAAAAGGGCATGTGCAGCTGGTGTCTGCCAGGGACAGCCCAGTCCCTGCCTTGTGGTTCCCAGGAAGAAGCTGCAA

CAATTCAGTGAATGATTAAAGGGCTGTTTGATAATAAGGCCTTCGTTCCACTCCTGTGGCTTTCCAAGTTCCTAATGAGGCTACAAAGGCTCCATCCATA

CAGAAAACCAATAATGTAAATAAAAGCCAATCCTGCAAGCATGGTTTGCAGAGGCGGGTGATGAATGTGAAGCCACCCGCAGGATGCATTTGAGTCTGGT

TTTTCTGTGCTTTGTCATTTGACTCAGTAGGAACTTTTGTTACTTAACTCTGTGCATAACTTATTTAATGTACTGTATAAATGAACCAAAACTGTTAAAT

ATGTATTTAGTTTGTTCTACTTAAAGTAGTTAATAAAAATGCTATATTCCTTTTCTGACTC
Translation
 - UNI124 - - UNI5148 - - UNI6252 - - UNI15813 - - UNI36409 - - UNI36874 -  - UNI6550 - - UNI15813 -

 - UNI21125 -  - UNI8574 - - UNI21125 - - UNI22506 - LQAPGGHKLSSSSICDSISQG - UNI9418 - - UNI9466 - -

 UNI18817 - - UNI22506 - GLNGGYQDELVDHRLTEREWADEWKHLDH ALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRFNENTELRK

TGTELVSRQHSPGSTDSLSND DSQREFTSRPATGYVPVEFWKKTE - UNI598 - - UNI33366 - EAVNKVKIQAMSEVQKAVAEAEQKAFEVI

ATERARMEQTIADVKRQAAEDAFLVINEQEESTE - UNI598 - - UNI22223 - NCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQS

LHGHSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL

For any suggestions or comments, please send an email to unitrap@crg.es