Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038546 (Ranbp9)
Chromosomal location
Chr 13: 43498748 - 43576342 (-)
Description
RAN binding protein 9 Gene [Source:MGI Symbol;Acc:MGI:1928741]
RefSeq_peptide
NP_064314.2 
UniGene
Mm.148781 
MGI
MGI:1928741 
Uniprot/SWISSPROT
P69566 
Human Ortholog
ENSG00000010017 (RANBP9)
Omim not available
UniTrap UNI4156
Vector Insertion
Chr 13: 43520584 - 43525816
Public Clones AM0815 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI562
Vector Insertion
Chr 13: 43518033 - 43520398
Public Clones BC0029 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045043
Sequence
GAAGCAGGGACGAGTGGAGGTGCCGCAGGCTGAGTCGCGGCCGGGATGTCCGGGCAGCCGCCGCCACCGCCGCCGCAACAGCAGCCGCCGCCGCCG CCG

CCCCCCGCCTCGGCGGCCGCCCCCGCCACCGCGCCGCCCGGCCTGGCGGTGGGCCCCGGCCCGGCCGCAGGCGTCCCGGTCCCGGGCCTGGCGGCGGGCA

GCAGCGCCGCTGCCCCTTTCCCGCACGGCGACTCGGCCCTCAACGAGCAGGAGAAGGAGCTGCAGAGGCGGCTGAAGCGCCTCTACCCGGCTGTGGATGA

GCAGGAGACGCCGCTGCCCCGGTCCTGGAGCCCGAAGGACAAGTTCAGCTACATCGGCCTCTCGCAGAACAACCTGCGGGTGCACTACAAAG GTCATGG

TAAAACCCCCAAAGATGCAGCATCTGTTCGAGCCACGCATCCAATACCAGCGGCCTGTGGGATTTATTATTTTGAAGTAAAAATTGTCAGTAAGGGAAGA

GATGG CTACATGGGAATTGGTCTTTCTGCTCAAGGTGTGAACATGAATAGACTACCAG GTTGGGATAAACATTCATATGGTTACCATGGGGATGATGG

ACATTCATTTTGTTCTTCTGGAACTGGACAACCGTATGGACCAACTTTTACAACTGGTGATGTCATTGGCTGTTGTGTTAATCTTATCAACAATACCTGC

TTTTACACGAAGAATGGACATAGTTTAG GTATTGCTTTCACCGACTTACCG - UNI4156 - CCAAATTTGTATCCTACTGTGGGGCTTCAGACACC

AGGAGAAGTGGTTGATGCCAACTTTGGGCAACATCCTTTTGTGTTTGATATAGAAGACTACATGCGAGAATGGAGAACCAAAATACAGGCCCAGATAGAC

CGCTTTCCTATCGGGGATCGAGAAGGAGAATGGCAGACCATGATCCAAAA - UNI562 - AATGGTTTCATCTTATTTAGTCCACCATGGGTACTGTG

CCACAGCAGAGGCCTTTGCCAGATCTACAGACCAGACTGTTCTAGAAGAATTAGCTTCCATTAAGAATAGACAAA GAATTCAGAAGTTGGTGTTAGCAG

GACGAATGGGAGAAGCCATTGAAACAACACAACAGTTATACCCAAGTTTACTTGAAAGAAATCCCAATCTCCTTTTCACATTAAA AGTACGTCAGTTTA

TAGAAATGGTGAATGGTACAGACAGTGAAGTGCGGTGTTTGGGAGGCCGAAGTCCAAAATCTCAAGACAGTTATCCCGTCAGTCCTCGACCCTTTAGTAG

TCCAAGCATGAGCCCCAGTCATGGAATGAGTATCCACAGCTTAGCACCAGGCAAAAGCAGCACTGCACATTTTTCTG GTTTTGAAAGTTGTAGCAATGG

TGTAATATCAAATAAAGCACACCAATCATATTGCCATAGTAAACACCAGCTATCCAGCTTGACTGTACCGGAGCTAAACAGTCTCAATGTATCAAGGTCA

CAGCAAGTTAATAACTTTACCAG TAATGATGTAGACATGGAAACAGATCACTACTCCAATGGAGTTGGAGAAACTTCATCCAATGGTTTCCTAAATGGT

AGCTCTAAACATGACCACGAAATGGAAGATTGTGACACCGAAATGG AAGTTGACTGCAGTCAGTTAAGACGCCAGCTGTGTGGAGGAAGTCAGGCTGCC

ATAGAGAGGATGATTCACTTTGGCCGAGAGCTACAAGCCATGAGTGAGCAGCTGAGGAGAGAATGTGGCAAGAACACAGCAAATAAGAAAATGCTGAAG 

GACGCATTCAGCTTACTAGCATATTCGGATCCTTGGAATAGTCCAGTTGGAAATCAGCTTGACCCAATTCAGAGAGAACCTGTGTGCTCAGCTCTTAACA

GTGCAATATTAG AAACCCACAATCTGCCAAAGCAACCTCCACTTGCCCTAGCCATGGGACAGGCCACACAGTGTCTAGGCCTGATGGCTCGGTCAGGAG

TTGGGTCCTGTGCATTTGCCACAGTGGAAGACTACCTACATTAGCTATGCACTTCAAGAGCTCACACTCACATTGTGGCAAACAGTCAACATGGAAGTAG

ACCGGCTCTGCTGATTTGAAATTTAGATTTTTTTTTAATTATGTACTGGGGACAGGTTTTTGTCGCTTTACATTGCTTCCTAGTTTACAGCATGATGCAA

ATGATTTTCTAACTTAGTGTTAGG
Translation
MSGQPPPPPPQQQPPPP PPPASAAAPATAPPGLAVGPGPAAGVPVPGLAAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDK

FSYIGLSQNNLRVHYKG GHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDG GYMGIGLSAQGVNMNRLPG GWDKHSYGYHGDDGHSFCSSGTG

QPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLG GIAFTDLP - UNI4156 - PNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQI

DRFPIGDREGEWQTMIQK - UNI562 - KMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQR RIQKLVLAGRMGEAIETTQQLYPSLLERNP

NLLFTLK KVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMSIHSLAPGKSSTAHFSG GFESCSNGVISNKAHQSYCHSKHQLS

SLTVPELNSLNVSRSQQVNNFTS SNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEME EVDCSQLRRQLCGGSQAAIERMIHFGRELQAMS

EQLRRECGKNTANKKMLK DAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILE ETHNLPKQPPLALAMGQATQCLGLMARSGVGSCAFATVEDYL

H

For any suggestions or comments, please send an email to unitrap@crg.es