Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038550 (Gm129)
Chromosomal location
Chr 3: 95682426 - 95686151 (-)
Description
gene model 129, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2684975]
Human Ortholog
not available
Omim not available
UniTrap UNI38266
Vector Insertion
Chr 3: 95682425 - 95684444
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036418
Sequence
GGAGGTGGGTCGGCTAGACCAGCACAGACAGTGAAGAAGCTGCATACCGACCGGGGCTGAACCGACAGACCCAG TTGCAGGTTCTGATCTTTGGTACTA

CGGGAGCTGCTCTTCAGCCCCTCTCCTGCTCCTGGACCTATGGATTCTCCATCTAGTGTTTCTTCTTATTCCTCCTCCTCCCTCTCCCCATCATTTTCCA

CGTCCTCTGTGAACAGTGACTTTAGCTTCCCTTCTGATAACGAGAGGGAGGGCAAGGGCACCCATGAGCTCAGGCCAGACACTGTGGGTCAGAGAGGAGG

TTCCAGGCCCAGTCCAGGCCCTATCCGCTGCAGACATCGACCCAGGGTTTCTAGTAACCAACATACAGCACCTCATCTGGAACAGCAAGGATCTGAAGTC

AAGAGATCAAGAGACGGTGAACAGGAGACGAGTCTGAACACCCAAGGATGTACTACAGAGGGAGATCTGCTCTTTGCTCAAAAG TGTAAAGAACTCCAA

GGGTTCATACGGCCCCTCACAGACCTACTGAACGGACTCAAGATGGGTCGCTTTGACAGAG GATTAAGTAGCTTCCAACAGAGTGTGGCCATGGACCGG

ATCCAGCGCATAGTGGGTGTTTTACAGAAGCCTCAGATGGG - UNI38266 - AGAACGTTATCTAGGAACCTTGCTGCAGGTGGAAGGGATGTTAAA

GACTTGGTTTCCTCACATAGCTGCCCAGAAGTCATCCTCAGGAGGTAGCCGGCACCAGATAAGCAAG - UNI38266 - CACTTTCCCAGCCACCACG

GTGACCCCGGGGCTGCTTCTCCTGCACCTCTCCTAGAGAAGATGGGCCAAACACAGCTGGGACATTTAGTTTTGAAACCAAAGCAGCCTTGGCATCTCAC

TGGATGGCCAGCTATGAACCTCACCTGGATTCATAGCACTCCAATTTGTAACCCTCCCCTCAGCTCCCAAGGCTCCGCCTCTGGCCACAGCCCCATAGGC

ACTGGAGCCAGCATTGGTGTCATCCTTGTCCTCCAGAAAGGAGGACAGCCCTTCACCCATTCTGCCCCGGGCACTCCGGTCCCACCAACTCCACTGTCTC

CTGTCGTCCCTGGTGATCTGAAGAAACTGCCTGGCGAGGAGCCTCGTTGCCACAGTTTGCCAGTAACACTGCCATCAGACTGGAGTTGCATCCTATGTCC

GCCTGTCCTGCCTACCACAGACAGAGAGATGACTAAAGGACACCCAGAGCCACAGATGACTAGCCATCCCCCAGTTGCTCCGGATCCTCAGCCCTAACCC

AGGCTCTGCTTCTTTCCCCTGATTCCCAATTTGTATAAATGTATGTTTTATGTGTATTTTTTTTTTTACTTTAATGTATTTGTGGTGAGGAAATAGAAAT

CCTTTCTGATTAAAGACATTTTTTACTT
Translation
 MDSPSSVSSYSSSSLSPSFSTSSVNSDFSFPSDNEREGKGTHELRPDTVGQRGGSRPSPGPIRCRHRPRVSSNQHTAPHLEQQGSEVKRSRDGEQETSL

NTQGCTTEGDLLFAQK CKELQGFIRPLTDLLNGLKMGRFDRG GLSSFQQSVAMDRIQRIVGVLQKPQMG - UNI38266 - GERYLGTLLQVEGML

KTWFPHIAAQKSSSGGSRHQISK - UNI38266 - HFPSHHGDPGAASPAPLLEKMGQTQLGHLVLKPKQPWHLTGWPAMNLTWIHSTPICNPPLSSQ

GSASGHSPIGTGASIGVILVLQKGGQPFTHSAPGTPVPPTPLSPVVPGDLKKLPGEEPRCHSLPVTLPSDWSCILCPPVLPTTDREMTKGHPEPQMTSHP

PVAPDPQP

For any suggestions or comments, please send an email to unitrap@crg.es