Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038576 (Susd4)
Chromosomal location
Chr 1: 184695037 - 184825785 (+)
Description
sushi domain containing 4 Gene [Source:MGI Symbol;Acc:MGI:2138351]
Human Ortholog
not available
Omim not available
UniTrap UNI37087
Vector Insertion
Chr 1: 184763407 - 184784087
Public Clones CMHD-GT_507G2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048739
Sequence
GCAAAGCCCAGGCACCGGGCCCCCAGGGTGGAGGAGGGAGAGCTTGGCCCCAGAGCCCGGGCAACCCCGGGGTATTGTCGTGTTCCGCTCCTGGTTGCAG

ACTCTCGCAAGCTGGATGCCCTCTGTGGATGAAAGATGTATCATGGAATGAACCCGAGCAATGGAGATGGATTTCTAGAGCAGCAGCTGCAGCAACAGCA

GCCTCAGTCCCCCCAGAGACTCTTGGCCGTGATCCTGTGGTTTCAACTGGCGCTGTGCTTTGGCCCTGCACAGCTCACGGGTG GGTTCGATGACCTCAA

CGTGTGTGCTGACCCAGGCGTCCCAGAGAATGGCTTCAGGACCCCCAGCGGAGGAGTTTTCTTCGAAAGCTCAGTAACCCGATTTCACTGCCAAGACGGA

TTCAGGCTGAAGGGCTCTACAAAGAGGCTGTGTATGAAACATTTTAATGGGACCCTAGGCTGGGTCCCAAGTGACAAACCTGTCTGCATACAAGAAG - 

UNI37087 - ACTGCCGCATCCCCCAAATTGAAGATGCTGAGATTCGAAACAAGACGTACAGACACGGAGAGAAGTTAGTCATTGACTGTCACGAGGGG

TTCAAGATCCGCTACCCTGACCTGTACAACCTGGTTTCGTTATGCCGTGACGATGGGACATGGGATAACCTGCCCATCTGTCAAG GCTGCCTGAGACCT

CTAGCCTCTTCCAATGGCTACGTGAACATCTCCGAGTTCCAGACCTCCTTCCCTGTGGGAACTGTGATCGCCTATCGCTGCTTCCCTGGATTTAAACTCG

AGGGTTCCGAGAACCTCGAGTGCTTACACAACCTTATCTGGTCGTCCAGCCCACCCCGGTGCCTTGCTCTGGAAG CCCAAGTTTGTCCACTACCTCCTA

TGGTAAGTCACGGAGATTTCATCTGCCACCCGAGGCCTTGTGAGCGCTACAACCATGGAACTGTGGTGGAGTTCTACTGTGATCCTGGCTACAGCCTCAC

CAGTGACTACAAGTACATCACCTGCCAGTATGGAGAGTGGTTTCCTTCCTACCAAGTCTACTGCATCAAATCAG AACAAACGTGGCCCAGCACCCACGA

GACCCTCCTGACCACGTGGAAGATCGTGGCGTTCACAGCCACCAGCGTGCTGCTGGTGTTACTGCTCGTCATCCTGGCCAGAATGTTCCAGACCAAGTTC

AAGGCCCACTTCCCCCCGAG GGGTCCTCCCAGGAGTTCCAGCAGTGACCCCGACTTTGTGGTCGTGGATGGAGTGCCCGTCATGCTCCCGACCTATGAT

GAGGCTGTGAACGGTAGCTCGAGTGCCTTAGGCCCGGGGTACCCGGCCTCCGTGGGCCAGGGCTGTCCTTTACCTGTGGATGACCAGAGCCCTCCAGCAT

ACCCCGGCTCCGGGGACACGGACACAGGCCCTGGGGAGTCAGAAACCTGTGACAGTACTTCGGGTTCCTCGGAGATGCTCCAGAGTCTATATTCACCCCC

CATGTGCCAAGGGGGCAGCCGCCCTGCCCCGGACACCCCTGACACGATTTCAAGCACAGCAGGGGAGGTGGCATCCACAAGCCCGGGCATCGACATTGCA

GATG AGATCCCGCTCATGGAAGAGGACCCATAGCCTGGTGACATCCTGCTAGTCCCACTGTCCCCTTTGGGGAAAAGAGCCTTGAAGAGAGACCACAGG

AGGACAGAGCTTGGGGACCAGGGGTCATTTTTAATCTATCTACATAAGGACAGTGATTCATACCGTACATCTCCAGCAGGACTGTGGGTCTGGCCAACAG

CAAAGGCGGTGCTTTCAAATGAGACTCAAGGGTTTATCATGACCAGCAGGGAACCAAGTGCAGAGGGGACTCTCTCTGCCTCACCCCTGTGTCAGAGCTG

GGTGTCTCTTGCTACAGAGCGTGAGACTGTGCCACACACATCCTGTTGCTCCTGCTAACAGCACTCCCTGCTCCTCTGAAAGCATGTCACATTGTATAAA

TTTGCTTCTAAAATCTGCTTTGAACTGTCTAGGGACTTTAGATCTGGACGGGTCAGCCTCT
Translation
MYHGMNPSNGDGFLEQQLQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG GFDDLNVCADPGVPENGFRTPSGGVFFESSVTRFHCQDGFRLKGSTKRL

CMKHFNGTLGWVPSDKPVCIQED - UNI37087 - DCRIPQIEDAEIRNKTYRHGEKLVIDCHEGFKIRYPDLYNLVSLCRDDGTWDNLPICQG GCL

RPLASSNGYVNISEFQTSFPVGTVIAYRCFPGFKLEGSENLECLHNLIWSSSPPRCLALEA AQVCPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPG

YSLTSDYKYITCQYGEWFPSYQVYCIKSE EQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPR RGPPRSSSSDPDFVVVDGVP

VMLPTYDEAVNGSSSALGPGYPASVGQGCPLPVDDQSPPAYPGSGDTDTGPGESETCDSTSGSSEMLQSLYSPPMCQGGSRPAPDTPDTISSTAGEVAST

SPGIDIADE EIPLMEEDP
Transcript ENSMUST00000085724
Sequence
GCAAAGCCCAGGCACCGGGCCCCCAGGGTGGAGGAGGGAGAGCTTGGCCCCAGAGCCCGGGCAACCCCGGGGTATTGTCGTGTTCCGCTCCTGGTTGCAG

ACTCTCGCAAGCTGGATGCCCTCTGTGGATGAAAGATGTATCATGGAATGAACCCGAGCAATGGAGATGGATTTCTAGAGCAGCAGCTGCAGCAACAGCA

GCCTCAGTCCCCCCAGAGACTCTTGGCCGTGATCCTGTGGTTTCAACTGGCGCTGTGCTTTGGCCCTGCACAGCTCACGGGTG GGTTCGATGACCTCAA

CGTGTGTGCTGACCCAGGCGTCCCAGAGAATGGCTTCAGGACCCCCAGCGGAGGAGTTTTCTTCGAAAGCTCAGTAACCCGATTTCACTGCCAAGACGGA

TTCAGGCTGAAGGGCTCTACAAAGAGGCTGTGTATGAAACATTTTAATGGGACCCTAGGCTGGGTCCCAAGTGACAAACCTGTCTGCATACAAGAAG - 

UNI37087 - ACTGCCGCATCCCCCAAATTGAAGATGCTGAGATTCGAAACAAGACGTACAGACACGGAGAGAAGTTAGTCATTGACTGTCACGAGGGG

TTCAAGATCCGCTACCCTGACCTGTACAACCTGGTTTCGTTATGCCGTGACGATGGGACATGGGATAACCTGCCCATCTGTCAAG GCTGCCTGAGACCT

CTAGCCTCTTCCAATGGCTACGTGAACATCTCCGAGTTCCAGACCTCCTTCCCTGTGGGAACTGTGATCGCCTATCGCTGCTTCCCTGGATTTAAACTCG

AGGGTTCCGAGAACCTCGAGTGCTTACACAACCTTATCTGGTCGTCCAGCCCACCCCGGTGCCTTGCTCTGGAAG TTTGTCCACTACCTCCTATGGTAA

GTCACGGAGATTTCATCTGCCACCCGAGGCCTTGTGAGCGCTACAACCATGGAACTGTGGTGGAGTTCTACTGTGATCCTGGCTACAGCCTCACCAGTGA

CTACAAGTACATCACCTGCCAGTATGGAGAGTGGTTTCCTTCCTACCAAGTCTACTGCATCAAATCAG AACAAACGTGGCCCAGCACCCACGAGACCCT

CCTGACCACGTGGAAGATCGTGGCGTTCACAGCCACCAGCGTGCTGCTGGTGTTACTGCTCGTCATCCTGGCCAGAATGTTCCAGACCAAGTTCAAGGCC

CACTTCCCCCCGAG GGGTCCTCCCAGGAGTTCCAGCAGTGACCCCGACTTTGTGGTCGTGGATGGAGTGCCCGTCATGCTCCCGACCTATGATGAGGCT

GTGAACGGTAGCTCGAGTGCCTTAGGCCCGGGGTACCCGGCCTCCGTGGGCCAGGGCTGTCCTTTACCTGTGGATGACCAGAGCCCTCCAGCATACCCCG

GCTCCGGGGACACGGACACAGGCCCTGGGGAGTCAGAAACCTGTGACAGTACTTCGGGTTCCTCGGAGATGCTCCAGAGTCTATATTCACCCCCCATGTG

CCAAGGGGGCAGCCGCCCTGCCCCGGACACCCCTGACACGATTTCAAGCACAGCAGGGGAGGTGGCATCCACAAGCCCGGGCATCGACATTGCAGATG A

GATCCCGCTCATGGAAGAGGACCCATAGCCTGGTGACATCCTGCTAGTCCCACTGTCCCCTTTGGGGAAAAGAGCCTTGAAGAGAGACCACAGGAGGACA

GAGCTTGGGGACCAGGGGTCATTTTTAATCTATCTACATAAGGACAGTGATTCATACCGTACATCTCCAGCAGGACTGTGGGTCTGGCCAACAGCAAAGG

CGGTGCTTTCAAATGAGACTCAAGGGTTTATCATGACCAGCAGGGAACCAAGTGCAGAGGGGACTCTCTCTGCCTCACCCCTGTGTCAGAGCTGGGTGTC

TCTTGCTACAGAGCGTGAGACTGTGCCACACACATCCTGTTGCTCCTGCTAACAGCACTCCCTGCTCCTCTGAAAGCATGTCACATTGTATAAATTTGCT

TCTAAAATCTGCTTTGAACTGTCTAGGGACTTTAGATCTGGACGGGTCAGCCTCT
Translation
MYHGMNPSNGDGFLEQQLQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG GFDDLNVCADPGVPENGFRTPSGGVFFESSVTRFHCQDGFRLKGSTKRL

CMKHFNGTLGWVPSDKPVCIQED - UNI37087 - DCRIPQIEDAEIRNKTYRHGEKLVIDCHEGFKIRYPDLYNLVSLCRDDGTWDNLPICQG GCL

RPLASSNGYVNISEFQTSFPVGTVIAYRCFPGFKLEGSENLECLHNLIWSSSPPRCLALEV VCPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYS

LTSDYKYITCQYGEWFPSYQVYCIKSE EQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPR RGPPRSSSSDPDFVVVDGVPVM

LPTYDEAVNGSSSALGPGYPASVGQGCPLPVDDQSPPAYPGSGDTDTGPGESETCDSTSGSSEMLQSLYSPPMCQGGSRPAPDTPDTISSTAGEVASTSP

GIDIADE EIPLMEEDP

For any suggestions or comments, please send an email to unitrap@crg.es