Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038578 (OTTMUSG00000007332)
Chromosomal location
Chr 4: 59327626 - 59451505 (-)
Description
predicted gene, OTTMUSG00000007332 Gene [Source:MGI Symbol;Acc:MGI:3651543]
UniGene
Mm.366418 
MGI
MGI:3651543 
Uniprot/SPTREMBL
A2AN91 B2RXU0 B2RY76 
Human Ortholog
ENSG00000106868 (SUSD1)
Omim not available
UniTrap UNI25915
Vector Insertion
Chr 4: 59403625 - 59424141
Public Clones not available
Private Clones OST151581 (lexicon) OST64063 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107544
Sequence
TCCCAACTCTCTGACCCGTCCAGTCAGAGACCCTTTCCTGTGGCTACTGCACTTCTCTGGTCTCCACAAGTCACACTTGCACTGCGATGTTTCCCCCCTA

GCACAGTCCGCTTTCTCCCCGTGGCTCAGCTCGCGCGCAGCCGGTGCACCAGGCGCACCTAGATCCGGGGACCTGGGACCCTGCTCCCCGCCGGGACCGG

CGCAACCCGGCGCCGGAAGCCTCTGCGCCGCCCCTTCCTCGCGCCTCTGGCCTTATCTCCTTGCACAGGGGCCTCCGGGGAGTGGCGGGCGCCGGGAGGG

AGCCAGCGGCATGGGCCGGGGTCCCCGGGGCACGCGCCGCTCTCCAGGATGCGGGTTGCAGCGGCTGCTGCGGCTCGTGCTGCTGCTCAGCCTAGCCCGC

GGCGTCAGCGGAGAGCCTGGCACGGAAG ATGTAGATGTCTGTGCCACGTGCCATGAACATGCCACATGCCAGCAAAAGGAAGGGAAGAGAATCTGCATT

TGCAACTATGGGTTTTGGGGCAACGGGAGGACACGGTGT ACAAAGATGAGTGCCAGTTTGGAGCCACTGTGATCTGTGGGAACCACACATCCTGCCACA

ACACGCCTGGAGGGTTCTACTGCATTTGCCACGAGGGCTACCGGGCCACAAATAACAACGAGACGTTCATCCCCAATGACGGCACTTTCTGTGCAG ACA

TCGATGAGTGTGAAGATTCTGGCCTGTGCAGACATGGAGGGCGGTGTGTCAATACTCCTGGGAGCTTTGCATGCTACTGCATGGAAGGGTATGTGGCAAA

GAACGGGCCTGAGCCTTTCCACCCACGCACGGATGCCACATCGTGCACAG AAATAGACTGTGGCATCCCTCCTGAAGTTCCTGAGGGCTACGTCGTGGG

AAGCTACAGCTCCACACTGGGCGGCCAGGCCCATTATAGCTGCAAGGAAGGGTTTCTCAGCGTCTCAGGAGACAGAATTTCACGATGCACAGCCCTGGGT

GTGTGGGAACCTCCCAAGTTACATTGCCAAG - UNI25915 - AGATCAGCTGTGGCAGCCCTCCTGAAATTCAGAACGCCATCTTGGTCGGGAATCA

CAGCTCCAGACAGGGGAGTGTGGCTCATTATGACTGTCAGGAGGGCTTTGAGAGTCCAGGAGGAAAGATCACTTCCGTTTGCACAGAGAAAGGCGCCTGG

AGTGAAATCACTTATGCATGCACAG AAATAATGATAGAAATTCATGATGTGTTGGTGTTTAATGACACCTGTGTGAGATGGCAAATAAGTCCAGAGAGA

GTGAACGCCAGGATCGTGTACTTG ATACGCGTTGAAAGACAGCAGCCGGATGCTGCGGAATCAGTTTATGAGGAGACAGTCAATGTGACCACAGACAGC

AGAACCCCAGAAGTGTGCCTGCACCTCCAACAAGGAACCAATTACACCATAAGCATTTCTGCAGCCCCTCCCAGGCGCTCTGTGCCCGCCATCCTTGGCT

TCCAGACCCCTG AAGATGATCTCTTAGAAGATGACGGACTTTTCAATATCTCAGTATTTAATGAAACTTGTTTGACGTTGAGCAGGCACTCTAGGCAAG

TTGGATCAGAACAAATGTACCAA GTGGAGGTTCTGGGTCAGAGGTGGTATCTAGAGAGCTCCTACCATGCTGCTCTCTTTAACTTCACAACAAGAGACC

GAGCTCCAGAAGTGTGTTTAGATCTGTACCCCGCTACTGATTACACGATAAACATCACCCTTCTGAGACCCACTGAGCCGCGCTCCGCACAAATAACCAT

AACAACCTCAGTGACAG CAAAACAGACCATCGCTAATATTTCGGTATATAATGATACCTGCCTGAGATGGAGCAGCCTCAAGACAGCTGATGTACTAGA

GATGTATTTA TTCCACATTTGGGGCCAGAGATGGTATCAGAAGGCATTTGTCCAGGAAATGGTCTTCAATACAACCAGCAGCAGCCAGGACCCTGAGAT

ATGCCTGGACCTGCATCAAGGCACCAGCTACAACGTTAGCCTTCAGGCTCTGTCTTCGGCACTTCCCGTGGTCATCTACCTGACAACCCAGATCACAG A

GCCCCCACTTCCTGAAGTAGACTTTTTCACTGTGCGGGGAAGGCCTCTACCACGCTTCACGCTGAGGAAAGTCAAGGAGATAAATGGACCTATCAG TTC

ATATCAGGTGTTGGTCCTTCCCCTGTCCTTGCAAAGCACATTTTCTTGTGATTCTGAAGGCATGACTTCATTCTTTGGCAACACTTCTCCTGCTGACGGA

TATGTGGCTGCAGAAATCCTGGCCAGTGATGTTCCAGACGACACGTTGGAGATATCTATTGGAGACAGGCTCTACTATGGGGAATATTACAATGCACCTT

TGAAAACAGGAAATGAGTACTGCATTCTGTTACGGATCACAAGTGAATGGAATAAG GTGAGAAGATATTCCTGTGCTGTCTGGGCTGAGGTAAAAG AC

TCATCGCTCACAGCGCAGCAGATGGTGGGTGTTGGACTGGGCTCCGTGGCTTTTGTGACCATCCTTGCATTCTTCTCCTTCTCAGCAGTGTG ATGGCTC

AGCCTGGGAAGACTGACTTGATGATGCACAGATGTTCTGACAGCTTCTCAGGCCCGTCTGTGGTGTGGCTCCCATCCTAAGCCCTGGTGTGGGGCTGAAA

CTTTCTCCAACCCAGCATGACCTCATTCCTGAATTTGAGATGATAGCCATCTCTGTGGAATCTTAAAACTTGGGAGCAGTTTATGTGTGCTTCGTGCTTT

CTGGATCAGTTGTATATCTGTGACCTCAAGACTCATGTCCAATGTAACACCACAGGCCACAGACCCTGTGAGTCAGCCCCTGTTTACACTGGATGTGGAC

AGGCCACAGACCCTGTGACTCAGGTCCCATAGACATTGGATGTTGAACCTCTGCCTCTTCCTTTAATTAGTTCATCTACTAACTAGTTCAGGATCTGTTC

TCCTCAACAGGTAATGAGATGGGCTTAAGTCTGGGCTGGAATTGATGAAGGAGCTCACCAGATAGAGAACAAATATGAATAGATATGAATAAATGTTTCA

AGCATTTTAGGATTCGCCCCTGGCCTATACCAGAAAGTACAATAGCCTGGCTACTCTCTCAGGTTCCCTTCGTGGCTTTGATATAATTCCTGTCGTTTGT

GTGAGACCAAAAGTGATGTCTGCTTTCCAGAAAAACCCATTCTGTAATT
Translation
 MPAKGREENLHLQLWVLGQREDTVY YKDECQFGATVICGNHTSCHNTPGGFYCICHEGYRATNNNETFIPNDGTFCAD DIDECEDSGLCRHGGRCVN

TPGSFACYCMEGYVAKNGPEPFHPRTDATSCTE EIDCGIPPEVPEGYVVGSYSSTLGGQAHYSCKEGFLSVSGDRISRCTALGVWEPPKLHCQE - UN

I25915 - EISCGSPPEIQNAILVGNHSSRQGSVAHYDCQEGFESPGGKITSVCTEKGAWSEITYACTE EIMIEIHDVLVFNDTCVRWQISPERVNAR

IVYL IRVERQQPDAAESVYEETVNVTTDSRTPEVCLHLQQGTNYTISISAAPPRRSVPAILGFQTPE EDDLLEDDGLFNISVFNETCLTLSRHSRQVG

SEQMYQ VEVLGQRWYLESSYHAALFNFTTRDRAPEVCLDLYPATDYTINITLLRPTEPRSAQITITTSVTA AKQTIANISVYNDTCLRWSSLKTADVL

EMYL FHIWGQRWYQKAFVQEMVFNTTSSSQDPEICLDLHQGTSYNVSLQALSSALPVVIYLTTQITE EPPLPEVDFFTVRGRPLPRFTLRKVKEINGP

IS SSYQVLVLPLSLQSTFSCDSEGMTSFFGNTSPADGYVAAEILASDVPDDTLEISIGDRLYYGEYYNAPLKTGNEYCILLRITSEWNK VRRYSCAVW

AEVKD DSSLTAQQMVGVGLGSVAFVTILAFFSFSAV V
Transcript ENSMUST00000040166
Sequence
ATGCCAGCAAAAGGAAGGGAAGAGAATCTGCATTTGCAACTATGGGTTTTGGGGCAACGGGAGGACACGGTGT ACAAAGATGAGTGCCAGTTTGGAGCC

ACTGTGATCTGTGGGAACCACACATCCTGCCACAACACGCCTGGAGGGTTCTACTGCATTTGCCACGAGGGCTACCGGGCCACAAATAACAACGAGACGT

TCATCCCCAATGACGGCACTTTCTGTGCAG ACATCGATGAGTGTGAAGATTCTGGCCTGTGCAGACATGGAGGGCGGTGTGTCAATACTCCTGGGAGCT

TTGCATGCTACTGCATGGAAGGGTATGTGGCAAAGAACGGGCCTGAGCCTTTCCACCCACGCACGGATGCCACATCGTGCACAG AAATAGACTGTGGCA

TCCCTCCTGAAGTTCCTGAGGGCTACGTCGTGGGAAGCTACAGCTCCACACTGGGCGGCCAGGCCCATTATAGCTGCAAGGAAGGGTTTCTCAGCGTCTC

AGGAGACAGAATTTCACGATGCACAGCCCTGGGTGTGTGGGAACCTCCCAAGTTACATTGCCAAG - UNI25915 - AGATCAGCTGTGGCAGCCCTC

CTGAAATTCAGAACGCCATCTTGGTCGGGAATCACAGCTCCAGACAGGGGAGTGTGGCTCATTATGACTGTCAGGAGGGCTTTGAGAGTCCAGGAGGAAA

GATCACTTCCGTTTGCACAGAGAAAGGCGCCTGGAGTGAAATCACTTATGCATGCACAG AAATAATGATAGAAATTCATGATGTGTTGGTGTTTAATGA

CACCTGTGTGAGATGGCAAATAAGTCCAGAGAGAGTGAACGCCAGGATCGTGTACTTG ATACGCGTTGAAAGACAGCAGCCGGATGCTGCGGAATCAGT

TTATGAGGAGACAGTCAATGTGACCACAGACAGCAGAACCCCAGAAGTGTGCCTGCACCTCCAACAAGGAACCAATTACACCATAAGCATTTCTGCAGCC

CCTCCCAGGCGCTCTGTGCCCGCCATCCTTGGCTTCCAGACCCCTG AAGATGATCTCTTAGAAGATGACGGACTTTTCAATATCTCAGTATTTAATGAA

ACTTGTTTGACGTTGAGCAGGCACTCTAGGCAAGTTGGATCAGAACAAATGTACCAA GTGGAGGTTCTGGGTCAGAGGTGGTATCTAGAGAGCTCCTAC

CATGCTGCTCTCTTTAACTTCACAACAAGAGACCGAGCTCCAGAAGTGTGTTTAGATCTGTACCCCGCTACTGATTACACGATAAACATCACCCTTCTGA

GACCCACTGAGCCGCGCTCCGCACAAATAACCATAACAACCTCAGTGACAG CAAAACAGACCATCGCTAATATTTCGGTATATAATGATACCTGCCTGA

GATGGAGCAGCCTCAAGACAGCTGATGTACTAGAGATGTATTTA TTCCACATTTGGGGCCAGAGATGGTATCAGAAGGCATTTGTCCAGGAAATGGTCT

TCAATACAACCAGCAGCAGCCAGGACCCTGAGATATGCCTGGACCTGCATCAAGGCACCAGCTACAACGTTAGCCTTCAGGCTCTGTCTTCGGCACTTCC

CGTGGTCATCTACCTGACAACCCAGATCACAG AGCCCCCACTTCCTGAAGTAGACTTTTTCACTGTGCGGGGAAGGCCTCTACCACGCTTCACGCTGAG

GAAAGTCAAGGAGATAAATGGACCTATCAG TTCATATCAGGTGTTGGTCCTTCCCCTGTCCTTGCAAAGCACATTTTCTTGTGATTCTGAAGGCATGAC

TTCATTCTTTGGCAACACTTCTCCTGCTGACGGATATGTGGCTGCAGAAATCCTGGCCAGTGATGTTCCAGACGACACGTTGGAGATATCTATTGGAGAC

AGGCTCTACTATGGGGAATATTACAATGCACCTTTGAAAACAGGAAATGAGTACTGCATTCTGTTACGGATCACAAGTGAATGGAATAAG GTGAGAAGA

TATTCCTGTGCTGTCTGGGCTGAGGTAAAAG ACTCATCGCTCACAGCGCAGCAGATGGTGGGTGTTGGACTGGGCTCCGTGGCTTTTGTGACCATCCTT

GCATTCTTCTCCTTCTCAGCAGTGTG ATGGCTCAGCCTGGG
Translation
MPAKGREENLHLQLWVLGQREDTVY YKDECQFGATVICGNHTSCHNTPGGFYCICHEGYRATNNNETFIPNDGTFCAD DIDECEDSGLCRHGGRCVNT

PGSFACYCMEGYVAKNGPEPFHPRTDATSCTE EIDCGIPPEVPEGYVVGSYSSTLGGQAHYSCKEGFLSVSGDRISRCTALGVWEPPKLHCQE - UNI

25915 - EISCGSPPEIQNAILVGNHSSRQGSVAHYDCQEGFESPGGKITSVCTEKGAWSEITYACTE EIMIEIHDVLVFNDTCVRWQISPERVNARI

VYL IRVERQQPDAAESVYEETVNVTTDSRTPEVCLHLQQGTNYTISISAAPPRRSVPAILGFQTPE EDDLLEDDGLFNISVFNETCLTLSRHSRQVGS

EQMYQ VEVLGQRWYLESSYHAALFNFTTRDRAPEVCLDLYPATDYTINITLLRPTEPRSAQITITTSVTA AKQTIANISVYNDTCLRWSSLKTADVLE

MYL FHIWGQRWYQKAFVQEMVFNTTSSSQDPEICLDLHQGTSYNVSLQALSSALPVVIYLTTQITE EPPLPEVDFFTVRGRPLPRFTLRKVKEINGPI

S SSYQVLVLPLSLQSTFSCDSEGMTSFFGNTSPADGYVAAEILASDVPDDTLEISIGDRLYYGEYYNAPLKTGNEYCILLRITSEWNK VRRYSCAVWA

EVKD DSSLTAQQMVGVGLGSVAFVTILAFFSFSAV V

For any suggestions or comments, please send an email to unitrap@crg.es