Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038587 (Akap12)
Chromosomal location
Chr 10: 5987073 - 6080178 (-)
Description
A kinase (PRKA) anchor protein (gravin) 12 Gene [Source:MGI Symbol;Acc:MGI:1932576]
RefSeq_dna
NM_031185 
RefSeq_peptide
NP_112462.1 
UniGene
Mm.27481 
MGI
MGI:1932576 
Uniprot/SWISSPROT
Q9WTQ5 
Uniprot/SPTREMBL
Q6IR43 B2RRE0 
Human Ortholog
ENSG00000131016 (AKAP12)
Omim not available
UniTrap UNI1668
Vector Insertion
Chr 10: 6032799 - 6079872
Public Clones (sanger) XR0032 (sanger) XQ0024 (sanger) CH0853 (sanger) RRJ560 (baygenomics)
CSH722 (baygenomics) RRI414 (baygenomics) RRU530 (baygenomics) XE004 (baygenomics)
YTA052 (baygenomics) P142A02 (ggtc) H002B09 (ggtc) M118A05 (ggtc)
P142G07 (ggtc) H005F05 (ggtc) E058E05 (ggtc) P142E07 (ggtc) H003C08 (ggtc)
D069B11 (ggtc) P144D02 (ggtc) H005H02 (ggtc) E139A06 (ggtc) A032B01 (ggtc)
D095C10 (ggtc) E117C03 (ggtc) H003E09 (ggtc) CMHD-GT_263B5-3 (cmhd) CMHD-GT_411F5-3 (cmhd)
CMHD-GT_437F3-3 (cmhd) CMHD-GT_539A8-5S (cmhd) CMHD-GT_340D7-3 (cmhd) CMHD-GT_421E12-3 (cmhd)
CMHD-GT_379A1-3 (cmhd) CMHD-GT_539A8-3S (cmhd) CMHD-GT_500E7-3 (cmhd) CMHD-GT_329B1-3 (cmhd)
CMHD-GT_437G6-3 (cmhd) CMHD-GT_539A8-3 (cmhd) CMHD-GT_347F8-3 (cmhd) CMHD-GT_503D4-3 (cmhd)
IST12786E6 (tigm) IST14947H4 (tigm) IST11777F1 (tigm) IST14491C6 (tigm)
IST10493D7 (tigm) IST12010H11 (tigm) IST12873D7 (tigm) IST10462H1 (tigm)
IST11744E9 (tigm) IST10692H1 (tigm) IST12577G6 (tigm) IST14608B10 (tigm)
IST10310G12 (tigm) IST11283D7 (tigm) IST14407F12 (tigm) IST11236A6 (tigm)
IST14451D2 (tigm) IST12909D2 (tigm) IST12905D12 (tigm) IST12068A11 (tigm)
IST10359C9 (tigm) IST10087A7 (tigm) IST14827D2 (tigm) IST10647E11 (tigm)
IST12235A4 (tigm) IST12058H2 (tigm) IST14871E5 (tigm) IST11727A12 (tigm)
IST13197A7 (tigm) IST13056G4 (tigm) IST10198G10 (tigm) IST12416E7 (tigm)
IST11859G4 (tigm) IST10361B11 (tigm) IST10377E6 (tigm) IST12366E11 (tigm)
IST12686E5 (tigm) IST12551A7 (tigm) IST12485D11 (tigm) IST10841H8 (tigm)
IST12905D7 (tigm) IST14937D3 (tigm) IST12340C2 (tigm) IST10457E8 (tigm)
IST12928D11 (tigm) IST14999E7 (tigm) IST12922D3 (tigm) IST15059B6 (tigm)
IST12583B10 (tigm) IST12714E9 (tigm) IST12894D1 (tigm) IST14474B5 (tigm)
IST11390B2 (tigm) IST14836B2 (tigm) IST12905D9 (tigm) IST11259D8 (tigm)
IST13230C10 (tigm) IST14924C5 (tigm)
Private Clones OST464623 (lexicon) OST457741 (lexicon) OST451803 (lexicon) OST448860 (lexicon)
OST430848 (lexicon) OST281599 (lexicon) OST233245 (lexicon) OST224704 (lexicon)
OST216198 (lexicon) OST198661 (lexicon) OST196365 (lexicon) OST171464 (lexicon)
OST142746 (lexicon) OST122868 (lexicon) OST97074 (lexicon) OST96945 (lexicon)
OST96909 (lexicon) OST96897 (lexicon) OST96877 (lexicon) OST87273 (lexicon)
OST87246 (lexicon) OST86942 (lexicon) OST86926 (lexicon) OST86922 (lexicon)
OST86910 (lexicon) OST86906 (lexicon) OST86874 (lexicon) OST86862 (lexicon)
OST86535 (lexicon) OST86511 (lexicon) OST83162 (lexicon) OST45091 (lexicon)
OST38323 (lexicon) OST36613 (lexicon) OST30846 (lexicon) OST30791 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI486
Vector Insertion
Chr 10: 5993400 - 6032683
Public Clones DB0008 (sanger) XS0076 (sanger) DB0007 (sanger) DB0016 (sanger)
DB0032 (sanger) (sanger) XE450 (baygenomics) XG216 (baygenomics) D053B08 (ggtc)
D063F05 (ggtc) W007E10 (ggtc) E038F09 (ggtc) CMHD-GT_272E7-3 (cmhd) CMHD-GT_330C11-3 (cmhd)
CMHD-GT_280E9-3 (cmhd) CMHD-GT_264H01-3 (cmhd) CMHD-GT_305C12-3 (cmhd) CMHD-GT_311G03-3 (cmhd)
CMHD-GT_297D2-3 (cmhd) IST14922B5 (tigm) IST15033H11 (tigm) IST14881G4 (tigm)
IST12840A2 (tigm) IST15052H3 (tigm)
Private Clones OST449280 (lexicon) OST403430 (lexicon) OST386099 (lexicon) OST378742 (lexicon)
OST247095 (lexicon) OST182948 (lexicon) OST53891 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4367
Vector Insertion
Chr 10: 5991351 - 5993400
Public Clones AF0116 (sanger) RRM026 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9726
Vector Insertion
Chr 10: 5988064 - 5991158
Public Clones XG087 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092717
Sequence
ATTCTCAGTCCGGGTGTGTTCTCAGCAGGATCGTGGAGAGCGGGTGCTCCTCACCCCTTAGTCCCTGTGGTCCTGGGCGCACATCTCCTCGCCCCTCTGC

TTCTCCGCGGTCCCAGGAAGACGGCTAGCCGGCGAGAGTAGGAAAGCCACTGAGCCATGGGTGCAGGCAGTTCCACCGAGCAGCGGAGCCCCGAGCAGCC

GGCGGAGAGCGACACGCCGAGCGAGCTGGAGCTCAGTGGCCATGGGCCCGCAGCGGAAGCGTCGGGAGCAGCTGGAGATCCCGCTGACGCGGACCCCGCC

ACCAAG - UNI1668 - CTCCCACAGAAGAATGGTCAGCTGTCTGCCGTCAATGGTGTAGCTGAACAAGAAGATGTCCACGTCCAAGAGGAAAGCCAG

GATGGGCAAGAGGAAGAAGTCACTGTTGAAGATG - UNI486 - - UNI4367 - TTGGACAGAGAGAGTCAGAAGATGTGAAAGAAAAAGACCGAG

CTAAAGAAATGGCAGCCAGTTCCACAGTTGTTGAAGATATCACAAAGGACGAGCAGGAGGAAACACCGGAAATAATCGAACAGATCCCTGCTTCAGAGAG

CAATGTGGAAGAAATGGCGCAGGCTGCTGAGTCCCAAGCTAATGACGTCGGCTTCAAGAAGGTATTTAAATTTGTTGGTTTTAAATTCACGGTGAAGAAG

GATAAAAACGAAAAGTCAGATACCGTCCAGCTACTCACTGTCAAGAAGGATGAAGGCGAAGGGGCAGAAGCCTCCGTCGGAGCAGGAGACCACCAAGAGC

CCGGAGTGGAGACCGTCGGCGAATCAGCATCCAAAGAAAGTGAGCTGAAGCAATCCACAGAGAAGCAAGAAGGCACCCTGAAGCAAGCACAGAGCAGCAC

AGAAATTCCCCTTCAAGCCGAATCTGGTCAAGGGACCGAGGAAGAAGCAGCCAAAGATGGAGAAGAAAACCGAGAGAAAGAACCTACCAAGCCCCTAGAA

TCTCCGACCAGCCCTGTCAGCAATGAGACAACATCTTCCTTCAAGAAATTCTTCACTCACGGCTGGGCCGGCTGGCGCAAGAAGACCAGCTTCAAGAAAC

CAAAGGAAGATGATCTGGAAACTTCCGAGAAGAGAAAGGAGCAAGAGGCTGAAAAAGTAGACGAGGAAGAAGGGGAAAAGACAGAGCCAGCCCCAGCCGA

GGAGCAGGAGCCTGCAGAAGGCACAGACCAGGCCAGGTTGTCAGCCGACTATGAGAAGGTGGAGTTGCCTTTGGAAGACCAGGTCGGTGACCTGGAGGCA

TTGTCGGAGAAGTGTGCTCCTTTGGCAACGGAAGTGTTTGATGAGAAGACGGAAGCCCACCAAGAAGTTGTTGCAGAGGTCCACGTGAGCACCGTGGAGA

AGATGACGAAAGGGCAAGGAGGAGCAGAGGTGGAAGGGGATGTGGTGGTGGAAGGATCGGGAGAATCCTTGCCCCCTGAGAAACTGGCTGAGACCCAGGA

GGTCCCCCAGGAAGCTGAGCCTGTGGAGGAGCTGATGAAGACCAAAGAAGTATGCGTCTCTGGGGGTGACCATACTCAGCTGACAGATCTAAGTCCTGAA

GAGAAGATGCTACCCAAACACCCCGAAGGCATTGTCAGTGAGGTGGAGATGCTGTCCTCTCAGGAGAGAATCAAGGTACAGGGAAGTCCCCTGAAGAAGC

TCTTCAGCAGTTCGGGCTTAAAGAAGCTCTCCGGGAAGAAGCAGAAGGGGAAGAGAGGAGGAGGCGGGGGAGATGAAGAGCCAGGAGAATACCAACACAT

TCAAACCGAGTCCCCAGAGAGTGCTGACGAGCAGAAGGGAGAGAGCTCTGCCTCTTCCCCTGAAGAGCCCGAGGAGATCGCGTGTCTGGAGAAGGGGCCA

TCGGAAGCACCCCAGGAAGCGGAAGCTGAGGAAGGAGCGACTTCCGACGGAGAGAAGAAAAGGGAAGGGATCACCCCCTGGGCATCCTTCAAAAAGATGG

TGACACCCAAGAAACGGGTCCGAAGACCTTCTGAGAGCGACAAGGAAGAAGAGCTGGATAAGGTCAAGAGTGCCACCTTGTCCTCCACGGAGAGCACGGC

GTCTGGAATGCAGGATGAGGTCAGAGCGGTTGGCGAGGAGCAAAGGTCAGAGGAGCCAAAGCGCAGGGTGGATACTTCAGTGTCTTGGGAGGCGTTGATT

TGTGTCGGATCGTCCAAGAAGAGAGCGAGGAAGGCATCCTCTTCAGATGATGAAGGAGGGCCAAGAACACTGGGAGGGGATGGCCACAGAGCGGAGGAGG

CTAGCAAAGACAAAGAAGCAGATGCTCTTCCTGCCAGCACCCAGGAACAAGACCAAGCGCACGGAAGTTCCTCACCCGAGCCAGCTGGAAGCCCTTCTGA

AGGGGAGGGCGTCTCCACCTGGGAGTCATTTAAGAGATTAGTCACTCCACGAAAAAAATCCAAGTCAAAACTGGAAGAGAGAGCCGAAGACTCCGGTGCA

GAGCAG - UNI4367 - TGGCCTCCGAGATCGAACCAAGTAGAGAGGAATCTTGGGTTTCCATTAAGAAATTTATTCCTGGACGGCGGAAGAAAAGGG

CAGATGGGAAGCAAGAACAGGCCGCCGTTGAAGACTCGGGGCCAGGAGAGATCAATGAGGACGACCCCGACGTCCCAGCTGTTGTGCCTCTGTCTGAGTA

CGATGCGGTAG
Translation
MGAGSSTEQRSPEQPAESDTPSELELSGHGPAAEASGAAGDPADADPATK - UNI1668 - LPQKNGQLSAVNGVAEQEDVHVQEESQDGQEEEVTVE

DV - UNI486 - - UNI4367 - VGQRESEDVKEKDRAKEMAASSTVVEDITKDEQEETPEIIEQIPASESNVEEMAQAAESQANDVGFKKVFKFVG

FKFTVKKDKNEKSDTVQLLTVKKDEGEGAEASVGAGDHQEPGVETVGESASKESELKQSTEKQEGTLKQAQSSTEIPLQAESGQGTEEEAAKDGEENREK

EPTKPLESPTSPVSNETTSSFKKFFTHGWAGWRKKTSFKKPKEDDLETSEKRKEQEAEKVDEEEGEKTEPAPAEEQEPAEGTDQARLSADYEKVELPLED

QVGDLEALSEKCAPLATEVFDEKTEAHQEVVAEVHVSTVEKMTKGQGGAEVEGDVVVEGSGESLPPEKLAETQEVPQEAEPVEELMKTKEVCVSGGDHTQ

LTDLSPEEKMLPKHPEGIVSEVEMLSSQERIKVQGSPLKKLFSSSGLKKLSGKKQKGKRGGGGGDEEPGEYQHIQTESPESADEQKGESSASSPEEPEEI

ACLEKGPSEAPQEAEAEEGATSDGEKKREGITPWASFKKMVTPKKRVRRPSESDKEEELDKVKSATLSSTESTASGMQDEVRAVGEEQRSEEPKRRVDTS

VSWEALICVGSSKKRARKASSSDDEGGPRTLGGDGHRAEEASKDKEADALPASTQEQDQAHGSSSPEPAGSPSEGEGVSTWESFKRLVTPRKKSKSKLEE

RAEDSGAEQ - UNI4367 - WPPRSNQVERNLGFPLRNLFLDGGRKGQMGSKNRPPLKTRGQERSMRTTPTSQLLCLCLSTMR
Transcript ENSMUST00000045730
Sequence
ATTCTCAGTCCGGGTGTGTTCTCAGCAGGATCGTGGAGAGCGGGTGCTCCTCACCCCTTAGTCCCTGTGGTCCTGGGCGCACATCTCCTCGCCCCTCTGC

TTCTCCGCGGTCCCAGGAAGACGGCTAGCCGGCGAGAGTAGGAAAGCCACTGAGCCATGGGTGCAGGCAGTTCCACCGAGCAGCGGAGCCCCGAGCAGCC

GGCGGAGAGCGACACGCCGAGCGAGCTGGAGCTCAGTGGCCATGGGCCCGCAGCGGAAGCGTCGGGAGCAGCTGGAGATCCCGCTGACGCGGACCCCGCC

ACCAAG - UNI1668 - CTCCCACAGAAGAATGGTCAGCTGTCTGCCGTCAATGGTGTAGCTGAACAAGAAGATGTCCACGTCCAAGAGGAAAGCCAG

GATGGGCAAGAGGAAGAAGTCACTGTTGAAGATG - UNI486 - - UNI4367 - TTGGACAGAGAGAGTCAGAAGATGTGAAAGAAAAAGACCGAG

CTAAAGAAATGGCAGCCAGTTCCACAGTTGTTGAAGATATCACAAAGGACGAGCAGGAGGAAACACCGGAAATAATCGAACAGATCCCTGCTTCAGAGAG

CAATGTGGAAGAAATGGCGCAGGCTGCTGAGTCCCAAGCTAATGACGTCGGCTTCAAGAAGGTATTTAAATTTGTTGGTTTTAAATTCACGGTGAAGAAG

GATAAAAACGAAAAGTCAGATACCGTCCAGCTACTCACTGTCAAGAAGGATGAAGGCGAAGGGGCAGAAGCCTCCGTCGGAGCAGGAGACCACCAAGAGC

CCGGAGTGGAGACCGTCGGCGAATCAGCATCCAAAGAAAGTGAGCTGAAGCAATCCACAGAGAAGCAAGAAGGCACCCTGAAGCAAGCACAGAGCAGCAC

AGAAATTCCCCTTCAAGCCGAATCTGGTCAAGGGACCGAGGAAGAAGCAGCCAAAGATGGAGAAGAAAACCGAGAGAAAGAACCTACCAAGCCCCTAGAA

TCTCCGACCAGCCCTGTCAGCAATGAGACAACATCTTCCTTCAAGAAATTCTTCACTCACGGCTGGGCCGGCTGGCGCAAGAAGACCAGCTTCAAGAAAC

CAAAGGAAGATGATCTGGAAACTTCCGAGAAGAGAAAGGAGCAAGAGGCTGAAAAAGTAGACGAGGAAGAAGGGGAAAAGACAGAGCCAGCCCCAGCCGA

GGAGCAGGAGCCTGCAGAAGGCACAGACCAGGCCAGGTTGTCAGCCGACTATGAGAAGGTGGAGTTGCCTTTGGAAGACCAGGTCGGTGACCTGGAGGCA

TTGTCGGAGAAGTGTGCTCCTTTGGCAACGGAAGTGTTTGATGAGAAGACGGAAGCCCACCAAGAAGTTGTTGCAGAGGTCCACGTGAGCACCGTGGAGA

AGATGACGAAAGGGCAAGGAGGAGCAGAGGTGGAAGGGGATGTGGTGGTGGAAGGATCGGGAGAATCCTTGCCCCCTGAGAAACTGGCTGAGACCCAGGA

GGTCCCCCAGGAAGCTGAGCCTGTGGAGGAGCTGATGAAGACCAAAGAAGTATGCGTCTCTGGGGGTGACCATACTCAGCTGACAGATCTAAGTCCTGAA

GAGAAGATGCTACCCAAACACCCCGAAGGCATTGTCAGTGAGGTGGAGATGCTGTCCTCTCAGGAGAGAATCAAGGTACAGGGAAGTCCCCTGAAGAAGC

TCTTCAGCAGTTCGGGCTTAAAGAAGCTCTCCGGGAAGAAGCAGAAGGGGAAGAGAGGAGGAGGCGGGGGAGATGAAGAGCCAGGAGAATACCAACACAT

TCAAACCGAGTCCCCAGAGAGTGCTGACGAGCAGAAGGGAGAGAGCTCTGCCTCTTCCCCTGAAGAGCCCGAGGAGATCGCGTGTCTGGAGAAGGGGCCA

TCGGAAGCACCCCAGGAAGCGGAAGCTGAGGAAGGAGCGACTTCCGACGGAGAGAAGAAAAGGGAAGGGATCACCCCCTGGGCATCCTTCAAAAAGATGG

TGACACCCAAGAAACGGGTCCGAAGACCTTCTGAGAGCGACAAGGAAGAAGAGCTGGATAAGGTCAAGAGTGCCACCTTGTCCTCCACGGAGAGCACGGC

GTCTGGAATGCAGGATGAGGTCAGAGCGGTTGGCGAGGAGCAAAGGTCAGAGGAGCCAAAGCGCAGGGTGGATACTTCAGTGTCTTGGGAGGCGTTGATT

TGTGTCGGATCGTCCAAGAAGAGAGCGAGGAAGGCATCCTCTTCAGATGATGAAGGAGGGCCAAGAACACTGGGAGGGGATGGCCACAGAGCGGAGGAGG

CTAGCAAAGACAAAGAAGCAGATGCTCTTCCTGCCAGCACCCAGGAACAAGACCAAGCGCACGGAAGTTCCTCACCCGAGCCAGCTGGAAGCCCTTCTGA

AGGGGAGGGCGTCTCCACCTGGGAGTCATTTAAGAGATTAGTCACTCCACGAAAAAAATCCAAGTCAAAACTGGAAGAGAGAGCCGAAGACTCCGGTGCA

GAGCAGTTGGCCTCCGAGATCGAACCAAGTAGAGAGGAATCTTGGGTTTCCATTAAGAAATTTATTCCTGGACGGCGGAAGAAAAGGGCAGATGGGAAGC

AAGAACAGGCCGCCGTTGAAGACTCGGGGCCAGGAGAGATCAATGAGGACGACCCCGACGTCCCAGCTGTTGTGCCTCTGTCTGAGTACGATGCGGTAGA

GAGAGAGAAGCTGGAAGCGCAGCGAGCTCAGGAGAACGTGGAGCTGCCCCAGCTGAAGGGGGCTGTGTATGTGTCTGAGGAGCTTAGTAAGACTCTGGTT

CACACCGTGAGTGTCGCGGTCATTGATGGGACCAGGGCAGTCACCAGTGCCGAAGAGCGGTCCCCTTCGTGGATATCTGCTTCCATGACAGAACCTCTTG

AGCACGCAGAGGGAGTGGCCACACCGCCTGTTGGAGAGGTCACTGAAAAAGACATCACTGCAGAAGCAACTCCTGCACTCGCCCAGACTTTACCAGGGGG

CAAAGATGCCCATGACGACATAGTCACCAGTGAAGTGGATTTTACCTCAGAAGCAGTGACAGCCGCAGAAACCACAGAGGCGCTCCGCGCTGAAGAACTT

ACCGAAGCATCAGGGGCAGAAGAGACCACAGACATGGTGTCTGCAGTTTCCCAGCTGTCCGACTCCCCGGACACCACAGAGGAAGCCACCCCAGTTCAGG

AGGTAGAGGGTGGCATGCTAGATACGGAAGAACAGGAGCGCCAGACGCAGGCCGTCCTCCAAGCCGTTGCAGACAAAGTGAAAGAGGACTCCCAGGTGCC

TGCAACCCAGACTCTGCAGAGAGCAGGGCCGAAAGCACTGGAGAAGGTGGAGGAGGTAGAGGAGGACTCCGAGGTGCTGGCTACCGAGAAAGAGAAGGAT

GTTGTGCCGGAAGGACCCGTGCAGGAAGCTGAAACTGAGCATCTTGCACAGGGCTCCGAGACTGTACAGGCTACCCCAGAGAGCCTTGAAGTTCCTGAAG

TCACAGAGGATGTAGACCGTGCCACCACATGCCAGGTTATCAAGCACCAGCAGCTGATGGAACAGGCTGTGGCCCCTGAGTCATCTGAAACCTTGACAGA

CAGTGAGACAAATGGAAGTACTCCCCTCGCAGATTCAGACACTCCAAACGGGACACAGCAAGACGAGACCGTTGACAGCCAGGACAGTAATGCCATTGCC

GCCGTCAAGCAGTCACAGGTCACTGAAGAGGAGGCAGCTGCTGCTCAGACGGAGGGGCCTTCAACACCATCTAGTTTTCCAGCCCAGGAAGAACACAGGG

AAAAACCAGGAAGGGATGTTCTAGAACCCACACAAGCGCTGGCTGCCGGGGCAGTGCCTATTCTGGCAAAGGCTGAGGTGGGTCAAGAGGGTGAGGCTGG

CCAGTTTGATGGAGAAAAAGTCAAAGACGGACAGTGTGTTAAAGAACTGGAGGTGCCTGTGCACACTGGACCCAACAGTCAAAAGACTGCTGACTTGACA

CGTGACAGTGAAGTAATGGAAGTGGCCAGATGTCAGGAAACTGAGAGTAATGAAGAACAGAGTATTAGCCCGGAGAAAAGAGAGATGGGAACCGACGTTG

AAAAGGAGGAAACAGAGACCAAGACAGAGCAAGCCAGTGAAGAACATGAGCAGGAAACAGCTGCTCCTGAGCATGAAGGAACCCACCCTAAGCCAGTCCT

GACAGCTGACATGCCTCACTCAGAGAGGGGAAAGGCACTGGGCAGCCTTGAAGGAAGCCCTTCTCTCCCAGACCAAGACAAAGCAGATTGCATAGAGGTT

CAAGTTCAAAGCTCAGACACACCAGTCACTCAAACAACCGAAGCTGTGAAAAAGGTCGAAGAAACTGTGGCAACTTCAGAGATGGATGAAAGTTTGGAGT

GTGCAGGTGCGCAATCATTACCAGCTGAGAAGCTCTCCGAAACCGGTGGCTACGGGACTCTTCAGCATGGAGAGGACACCGTGCCCCAGGGGCCTGAGTC

TCAGGCAGAGTCCATCCCAATAATAGTAACTCCTGCTCCTGAAAGCATCCTACATTCTGACCTTCAAAGAGAAGTGAGCGCATCCCAGAAACAGAGATCA

GATGAAGATAACAAGCCAGATGCTGGTCCTGATGCTGCCGGCAAGGAGAGTGCAGCAAGAGAGAAAATCCTCAGGGCTGAACCTGAGATCTTGGAACTTG

AGAGTAAGAGCAATAAGATTGTCCAGAGTGTCATCCAGACAGCCGTCGACCAGTTTGCACGTACAGAAACAGCCCCCGAAACCCACGCTTCTGATTTACA

GAATCAGGTTCCTGTGATGCAGGCTGACAGCCAGGGAGCACAACAGATGCTGGACAAAGATGAAAGCGACCTTCAAGTCTCCCCCCAAGATGGAACACTC

AGTGCCGTAGCCCAGGAAGGACTTGCGGTTTCTGATAGTTCTGAAGGCATGAGCAAGGCTTCAGAAATGATCACCACGCTTGCAGTTGAAAGTGCCAGTG

TCAAAGAAAGTGTTGAGAAGCTGCCTCTTCAGTGCAAAGATGAAAAGGAACATGCTGCTGACGGCCCCCAGCACCAAAGCTTAGCCAAGGCAGAGGCGGA

TGCCTCTGGAAATCTAACCAAAGAGTCCCCAGACACCAACGGACCAAAGCTAACCGAGGAAGGAGATGCCCTGAAAGAAGAAATGAACAAGGCCCAGACA

GAAGAGGACGACCTACAGGAGCCAAAGGGAGACCTGACAGAATCCTAAGACGTGAG - UNI9726 - TTGCTCATTGTAAAACTAGAATGTGAAGTGA

AGTCACGGAACAAGATGCTGCTGTTGGGACCTTGAGACCAAAATTTCAGAGCCCTTGAGGTGCAGAGAGCAGAGCCGTCCAATGATTTCAACCCTGCAGA

GCACCCCGACAATCCTGAGGCTGCATCGGGAGCTAGAGCCAGCTAACATTTCCTCTTTTCAAGACTGCCCTTGATTTGCCCCTTGGTGCCATGTATTTCA

GAGTTAAGGTCCTGCTTTCTCCACCTGGAACCAATGTCGGCAATACCTAGTCCCACTTCTCAAACTGGAGCCTCCTCCTTTATGTATTTATATGTATGTT

TTATGTAGTCCTCCTCCTGTACCTATTGTATATTTTTTTTCTAAGGTTTAAGCACATGCCTTTTGTATTATGCAGTATATAATGGGTGTGCAGCCATAGC

GAAGCTTTGAGAAGCCCCAAGCCTCAACTGTAACCTGCAGCAAACAGAGAAATAACATTCCTGGCAGGAAGATACAAGTCTTTTTAAAGTTTACTGATGC

TTAACTCTGTGGGCTCGTAGTCCTCTGAAAGTGGTTGTTTTCCTATGCACAGTGAGCTCAGAAATAAAAACTCCATTTTGAGACATTCAGAATGTCCCAA

CATTACGACAACATTTTTTTTTTTTTTTTCTAATCCAGTCCAGGTTGGAAAGAAGTCTCCTTAGTGTCAGATTAAGCCCCATCTCTTAACAATATGGACA

GATGAGTGTGCCATGGCCATGAGCTATTTCCTAACGCAGAAGGAATTTGTTGTTACTTTTTGGATTGTACTCTTCTAGGCTGGACCGAATTCATATGCAG

ATTGAAGTGAGACCTGCTCTTTACAGATGGTATTTTGATAGATACTGGAGTTTGTCTGTATTATATCTGTGCCCCTTCTTTTAAGAACAATGTTACATTA

TGTTCCTTTGGATAAATTGTGATTTGACAACTGATTTCAATAAAAATATTTGCTTCACTT
Translation
MGAGSSTEQRSPEQPAESDTPSELELSGHGPAAEASGAAGDPADADPATK - UNI1668 - LPQKNGQLSAVNGVAEQEDVHVQEESQDGQEEEVTVE

DV - UNI486 - - UNI4367 - VGQRESEDVKEKDRAKEMAASSTVVEDITKDEQEETPEIIEQIPASESNVEEMAQAAESQANDVGFKKVFKFVG

FKFTVKKDKNEKSDTVQLLTVKKDEGEGAEASVGAGDHQEPGVETVGESASKESELKQSTEKQEGTLKQAQSSTEIPLQAESGQGTEEEAAKDGEENREK

EPTKPLESPTSPVSNETTSSFKKFFTHGWAGWRKKTSFKKPKEDDLETSEKRKEQEAEKVDEEEGEKTEPAPAEEQEPAEGTDQARLSADYEKVELPLED

QVGDLEALSEKCAPLATEVFDEKTEAHQEVVAEVHVSTVEKMTKGQGGAEVEGDVVVEGSGESLPPEKLAETQEVPQEAEPVEELMKTKEVCVSGGDHTQ

LTDLSPEEKMLPKHPEGIVSEVEMLSSQERIKVQGSPLKKLFSSSGLKKLSGKKQKGKRGGGGGDEEPGEYQHIQTESPESADEQKGESSASSPEEPEEI

ACLEKGPSEAPQEAEAEEGATSDGEKKREGITPWASFKKMVTPKKRVRRPSESDKEEELDKVKSATLSSTESTASGMQDEVRAVGEEQRSEEPKRRVDTS

VSWEALICVGSSKKRARKASSSDDEGGPRTLGGDGHRAEEASKDKEADALPASTQEQDQAHGSSSPEPAGSPSEGEGVSTWESFKRLVTPRKKSKSKLEE

RAEDSGAEQLASEIEPSREESWVSIKKFIPGRRKKRADGKQEQAAVEDSGPGEINEDDPDVPAVVPLSEYDAVEREKLEAQRAQENVELPQLKGAVYVSE

ELSKTLVHTVSVAVIDGTRAVTSAEERSPSWISASMTEPLEHAEGVATPPVGEVTEKDITAEATPALAQTLPGGKDAHDDIVTSEVDFTSEAVTAAETTE

ALRAEELTEASGAEETTDMVSAVSQLSDSPDTTEEATPVQEVEGGMLDTEEQERQTQAVLQAVADKVKEDSQVPATQTLQRAGPKALEKVEEVEEDSEVL

ATEKEKDVVPEGPVQEAETEHLAQGSETVQATPESLEVPEVTEDVDRATTCQVIKHQQLMEQAVAPESSETLTDSETNGSTPLADSDTPNGTQQDETVDS

QDSNAIAAVKQSQVTEEEAAAAQTEGPSTPSSFPAQEEHREKPGRDVLEPTQALAAGAVPILAKAEVGQEGEAGQFDGEKVKDGQCVKELEVPVHTGPNS

QKTADLTRDSEVMEVARCQETESNEEQSISPEKREMGTDVEKEETETKTEQASEEHEQETAAPEHEGTHPKPVLTADMPHSERGKALGSLEGSPSLPDQD

KADCIEVQVQSSDTPVTQTTEAVKKVEETVATSEMDESLECAGAQSLPAEKLSETGGYGTLQHGEDTVPQGPESQAESIPIIVTPAPESILHSDLQREVS

ASQKQRSDEDNKPDAGPDAAGKESAAREKILRAEPEILELESKSNKIVQSVIQTAVDQFARTETAPETHASDLQNQVPVMQADSQGAQQMLDKDESDLQV

SPQDGTLSAVAQEGLAVSDSSEGMSKASEMITTLAVESASVKESVEKLPLQCKDEKEHAADGPQHQSLAKAEADASGNLTKESPDTNGPKLTEEGDALKE

EMNKAQTEEDDLQEPKGDLTES - UNI9726 - 

For any suggestions or comments, please send an email to unitrap@crg.es