Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038598 (AI481877)
Chromosomal location
Chr 4: 59056625 - 59151855 (-)
Description
Likely orthologue of H. sapiens chromosome 9 open reading frame 84  [Source:UniProtKB/TrEMBL;Acc:A2ALV5]
MGI
MGI:2140313 
Uniprot/SPTREMBL
A2ALV5 Q3UXC4 
Human Ortholog
ENSG00000165181 (C9orf84)
Omim not available
UniTrap UNI28519
Vector Insertion
Chr 4: 59056840 - 59060144
Public Clones CMHD-GT_455G3-3 (cmhd)
Private Clones OST28964 (lexicon) OST20995 (lexicon) OST17973 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107547
Sequence
GCTTGCTGCGTGAGACTGAGTAACTGCTAGATCCTTGGACTTCCATTCACAGCTGTGACTGAACGATTGTTGGGAATTGAGCTGCCGACT ATATTGGAC

TTTGTATGGCATTGAACGGAAGAACTATGTTTCCAGCCTTCAAATATTATGCAATAGACTATTTACAAGAG GACATAATTAAAGAGAGGCTTTACAGAG

ATGCTTTATTGCTTCAGATTCCTTCATGTTTAAATCAAGATAAAAACATTATTGATGATAAATATAGGACTCCATGGACAAGAG CTATTCCAGTTCAGG

AAATGGAAGATAATTCAGTCTTGGAGCAGTGGAGAACAAGATTCTGTGTGGAGGGTGTTCCTGAGAA AAAGACAGTTACAGGAGTGATGATTAATGGCA

CATTTGAGGAAATTGTTCCAAGTTCCAATCCAAACTCTCCACCTGGAATAGAGAACGATAAACTGTTCCCCAGTAAGGACTACGTAGACGACTTTATTCC

TGTCAAGTGTTCCTTGTACTACCCCGGAGTGAAAGCGGAGCACCAAG GATTGCTTATTGATGAGGAAATGATTTTTATGAATAAAGCAATGGACAACCA

TCTACCAACTGTGAATGGTCTCCTGAGCAGACTGAAGCTCTATCTGGTGAAGGATCCATTTTTAGATTTCAAAGAAGAGCTCTCTGGAAAGGATAATTTC

AC GGAGTATTTCTCTGTTCAAGAATGTTCGGAACCTTTTGTGAGAGATTTCCATATGGCTGAGGAGACCTTTTGTAAGAAGAAACTA CCATCAGTTTT

TCCTTCTGGGTTTAAATCCTTGATATCTACAAATCCCAAACAAGAAATTCTCATTCTACCACCATCAAAACTGAAGAAACCATTAAACTCGATACCGAAA

ATAATGGACTCTGTAGATGAAAGTGAATGTTTCAAAGGAG ACATTACTTCCAAGCATGAATTTGATACTGAGGATATAAAATGCAACTCCACAGAAAAC

TTAACATTTGCAAGCCTTTGTGAACCAGAGTGCAGTGAGCCAG GAGACCTAGAAATGCCACCAACCCATCTAATCTTACCAAGGCAGCATTCTGCAGTG

AGTTCATTACACATGGGATTTCAGACATTTCCGTTTTCTGCTACATGTAAAAT TAATTTGCTTAGTGCTGGAGAATCAGCTAATAAATATTGTATGCTG

TGGCAACTGGGAGGCTGCAGAAACTCTTGGGTCTCGTTCTTGCTTACAG TTCCAAGATTTCAAGAACCCAGCAGTCAATATTCACTTGCAGATATGAGG

AACATCTTTTCTGTCAAAGGAGACAGCCTTGTGATTAACCCTGCAAAAGCAAAGGGGTGGAGACAAGCACGACTACATCCAATAATGGCTGAAACGCTGG

CGCATCTGAAGGCGTATTTGTGTCATAATGGTCTGTCTTCTCAGGAGACTAAGCTGGAGATCTTTCTGCCTACAAAAGTGTTTCAGCTGGAGT CCTGGC

TAGAACTTAAGAGTCGTCCCTTGCCCATTGTGCCAATCAGTGAGAAATCTACAGATGTTCACCAGTTACATCCACAGAAGAGACCAATACCCTCTTCAGA

AAAGGAAGTACCACACCTTTGTTTGTCCGGTGAAAGTATCTCTGTTAAAAAATCCAAAGTAGAAGCAAACCCAAAGAATGATCAAGAACCAGAAGCTAGA

ATAATGCAGAAGCCGGAGAACAGCTGTGTTGGACTTGGCTGTTCAAGTCAAGTGCCATCTGCTGAATCAGCTTCCTCTTCCCAGATCCAGGCATCTTATG

ATAAAAAACAAGATGATTTGGACCTTCTGAGCGAGTTTATTATTCTGAGAAGTAAACACCAGACTTTCCCTTCAGAAGCTGACGTCGATGTCAAAAGCCA

TGACCATGACCAAAACAATG AATTTCAAGATAAAGAAAAATATTCTTTGACTCTTCAAGAAGAAAGTCTTGTTGCTTCTAATAGTAAAGCTCCAGAGGA

GAGATGTGAAGAAAGGACAGATGGCGTCATCGAGATCCCCGCTTCAG ACACCCAGTGCCAAGCATACTGTCTCCTAGAAGCCACAGCGAATCCTATCTT

AAAGGAGCTTGTTTGCCTCTGTACTTACCCTGCAGCCAATTGGAAATTCGCCACTGTCAATTTTGACCAAACAAGATTCTTCTTAAAGGAACAAGAAAAA

AAGATAAATGATGCTACTCACCCCG ATAAAAATGATGACAGAAAGATGACATTCAGGCATGCTGCTCTCTTACATCTCCTGATAACAATTAGAGACGTC

CTTTTAACATGCAACTTGGATACTGCATTAG GATATTTGTCAAATGCAAAAGATATCTACAAAAGTGTGTTAGACTCCCGTTTGGATAACATTTGGAGA

CAGCTGAAAATTTTACAGTTTATTAAGGAAAAAAGGCCTAAAAGCAACTATAAGATCCAAGAATTGCAGTGTCAAATACTAAGTAGGCTACAGAATCAAC

AACAAATGAAG GTACTGATTATAATAAGAATGGACTCAGATGGAGAAAAGCATCTGCTTATTAAAACACTTAAGAAAATAGAAG GTTTAACAATGACT

GTTTTACGTTCTAATGATAGAAAAAAAATTCTGGAAACTACCAGTATTTTAAAAGG TACGAATGCCTGCGTGGTTGTGCACAACCACAGTATCGGAGCG

GATTTCCCCTGGAGCAGCTTCTCGCTCGTGGTGGAGTACAACCATGTGGGGCACTCTTGCTGGGCCGAGCACTGCCAACTGTTGGATATACCTTTTCTGG

CCTTTAAAGTCGCTGTTCCAGACACAGCTCTGCAGA GAGATGCCTTGCTGGATGGATTTGGTGGGTTTCTCTTGAAAATTCCCATTCCATATGTATTTT

TTGCATCTGAAGGACTTCTCAATACTCCAGAGATACTCCGGCTGCTGGAGTCCAA CTATAATATCACACTAGTGGAGAGATGCTGCTGTGGGTCACTGA

AACTCTTTGGAAGTACAGAGTGCTATGTGGTGGTGACAGTCGACGAGCATACTGCTATAGTTGTGCAG GACCTAGAAGAGTTACATCATGAGAAGGCAT

CAGACAATATCATCATGAGATTAATGGCACTGTCGTTCCAGTATAGCTGTTGCTGGATAATACTATATTCCAAGGAAACACTAAATTCACA ATACCATC

TTACAGAAGAGACACTTCGTCACCTCGCACAGGTTTATGCAGCTCTGGTTTCCTCGGGCCTGAAATCTGAAGAGCTGGATGTAAAG CTTATAATTGCCC

CTGGAGTAGAAGAGACTGCTTTAATAATTCGACAAATTGCAGACCACAATTTAATGACGTCGACGAGAGATCCCCATGAATGGTTGGATAAATCCTGGGT

GGAAGTTTCACCTTCTAAG GAGGAAATGAGCCTACTTGATTTTCCCTGTATAAACCCACTGGTGGCTCAGCTCATGTTACACAGGGCGCCTTCGCTGCA

CTGGCTCCTGATAGCAACGCCTGCTGAGCTCCAGGAACTCCTGCCCCAGGTTCCAGGCAAAGTACTGAAG CATTTTTGCAGCATCACTTCCTTGTTCAA

GATTAGTTCTCCCTCCATGACAAAGTCTTCTCAGATTTCATCACTTCAGGAAGATATGAATCAAACTGATCTCTTTATTTCTCAGAGTTCAGCTCCTATC

ATTCAAGAACAGGAGGAATATTATCCCTATGAAGACTCGGAAGGCACAAGCTCTTCTCCTGTGGAGCTAAGAGCAACTCCATGCATGCTGCCATCTGCAG

CACCGCACAGTCAGAGGGGCTGCTGGGAGGACCCCAGCTGTGGCCCTGACCCCGTGCAGAATAACCCTTCCCTAATGAATGCAGAATCAAAGAAAGTCAC

CTGGCCCTCCGTTCCCAGCTGGAGTGATTCAGAATCAGATGTCTTTTCTCTGGCCCGAACACAAGTAAGTTGTGAACCCATAATGACACTAACTGATTCT

CAAAGGAGAGGCACAAATGGTTTTGTAAATTGTCCCGAAGCCAAAGGACCCAGAAACATGCAAGTGTCCACCCCTGTCTTTTTACCAGAGAACTCCCAGT

CCCACCTTCACTGGGACTTTAAGAAAAACAGTTGTAGAAAACAGATTTACTCGTTCAATCCAAGCTGTGGAACAGAACAGACTACTTACAACAAATGGTA

CTCTTGGAAAGATGACTTCTCCAGTAATCAGCCCGAGTGTCTGTGGGATGAGATGGAAGATGTCACATACAGAAATGCAAATGCTGGGACCCGGGAGACT

TTTTGGAGAGAACTGCCAGCTGTTCCAAGTTGGGATTCACCCTGTGCTTCTGATTCTAATGCAAATCAAAGAGGGTTCAAGGGCCTTGATTTCTGCCAAA

GAGCTGGAAACTACTTAGGACAGAGAAGCCTCCCTGTGTCTTCATCTAATTGGGGAGATTACAAAACACCAACAG - UNI28519 - ACTTAATGTAC

TCACAAGTACCACAACCCAAGAAACGACGTCTAATGTATGAGAAAGTCCCTGGAAGAGTGGATGGGCAAACCCGGCTGAAGTTTTTATGAAAAAAACAGA

AGGGACAGTGCCACCTGCCAGATTCTATTTCCTTATGCCAATCCAGTAACCAAGTATTTAGGCTTGACTCCACATCAAAGAAAATGCCATTGTTTTTACA

TGTC
Translation
 MALNGRTMFPAFKYYAIDYLQE DIIKERLYRDALLLQIPSCLNQDKNIIDDKYRTPWTRA AIPVQEMEDNSVLEQWRTRFCVEGVPEK KKTVTGVM

INGTFEEIVPSSNPNSPPGIENDKLFPSKDYVDDFIPVKCSLYYPGVKAEHQG GLLIDEEMIFMNKAMDNHLPTVNGLLSRLKLYLVKDPFLDFKEELS

GKDNFT TEYFSVQECSEPFVRDFHMAEETFCKKKL PSVFPSGFKSLISTNPKQEILILPPSKLKKPLNSIPKIMDSVDESECFKGD DITSKHEFDTE

DIKCNSTENLTFASLCEPECSEPG GDLEMPPTHLILPRQHSAVSSLHMGFQTFPFSATCKI INLLSAGESANKYCMLWQLGGCRNSWVSFLLTV VPR

FQEPSSQYSLADMRNIFSVKGDSLVINPAKAKGWRQARLHPIMAETLAHLKAYLCHNGLSSQETKLEIFLPTKVFQLES SWLELKSRPLPIVPISEKST

DVHQLHPQKRPIPSSEKEVPHLCLSGESISVKKSKVEANPKNDQEPEARIMQKPENSCVGLGCSSQVPSAESASSSQIQASYDKKQDDLDLLSEFIILRS

KHQTFPSEADVDVKSHDHDQNNE EFQDKEKYSLTLQEESLVASNSKAPEERCEERTDGVIEIPASD DTQCQAYCLLEATANPILKELVCLCTYPAANW

KFATVNFDQTRFFLKEQEKKINDATHPD DKNDDRKMTFRHAALLHLLITIRDVLLTCNLDTALG GYLSNAKDIYKSVLDSRLDNIWRQLKILQFIKEK

RPKSNYKIQELQCQILSRLQNQQQMK VLIIIRMDSDGEKHLLIKTLKKIEG GLTMTVLRSNDRKKILETTSILKG GTNACVVVHNHSIGADFPWSSF

SLVVEYNHVGHSCWAEHCQLLDIPFLAFKVAVPDTALQR RDALLDGFGGFLLKIPIPYVFFASEGLLNTPEILRLLESN NYNITLVERCCCGSLKLFG

STECYVVVTVDEHTAIVVQ DLEELHHEKASDNIIMRLMALSFQYSCCWIILYSKETLNSQ QYHLTEETLRHLAQVYAALVSSGLKSEELDVK LIIAP

GVEETALIIRQIADHNLMTSTRDPHEWLDKSWVEVSPSK EEMSLLDFPCINPLVAQLMLHRAPSLHWLLIATPAELQELLPQVPGKVLK HFCSITSLF

KISSPSMTKSSQISSLQEDMNQTDLFISQSSAPIIQEQEEYYPYEDSEGTSSSPVELRATPCMLPSAAPHSQRGCWEDPSCGPDPVQNNPSLMNAESKKV

TWPSVPSWSDSESDVFSLARTQVSCEPIMTLTDSQRRGTNGFVNCPEAKGPRNMQVSTPVFLPENSQSHLHWDFKKNSCRKQIYSFNPSCGTEQTTYNKW

YSWKDDFSSNQPECLWDEMEDVTYRNANAGTRETFWRELPAVPSWDSPCASDSNANQRGFKGLDFCQRAGNYLGQRSLPVSSSNWGDYKTPTD - UNI2

8519 - DLMYSQVPQPKKRRLMYEKVPGRVDGQTRLKFL
Transcript ENSMUST00000095066
Sequence
ATAGGACTCCATGGACAAGAG CTATTCCAGTTCAGGAAATGGAAGATAATTCAGTCTTGGAGCAGTGGAGAACAAGATTCTGTGTGGAGGGTGTTCCTG

AGAA AAAGACAGTTACAGGAGTGATGATTAATGGCACATTTGAGGAAATTGTTCCAAGTTCCAATCCAAACTCTCCACCTGGAATAGAGAACGATAAAC

TGTTCCCCAGTAAGGACTACGTAGACGACTTTATTCCTGTCAAGTGTTCCTTGTACTACCCCGGAGTGAAAGCGGAGCACCAAG GATTGCTTATTGATG

AGGAAATGATTTTTATGAATAAAGCAATGGACAACCATCTACCAACTGTGAATGGTCTCCTGAGCAGACTGAAGCTCTATCTGGTGAAGGATCCATTTTT

AGATTTCAAAGAAGAGCTCTCTGGAAAGGATAATTTCAC GGAGTATTTCTCTGTTCAAGAATGTTCGGAACCTTTTGTGAGAGATTTCCATATGGCTGA

GGAGACCTTTTGTAAGAAGAAACTA CCATCAGTTTTTCCTTCTGGGTTTAAATCCTTGATATCTACAAATCCCAAACAAGAAATTCTCATTCTACCACC

ATCAAAACTGAAGAAACCATTAAACTCGATACCGAAAATAATGGACTCTGTAGATGAAAGTGAATGTTTCAAAGGAG ACATTACTTCCAAGCATGAATT

TGATACTGAGGATATAAAATGCAACTCCACAGAAAACTTAACATTTGCAAGCCTTTGTGAACCAGAGTGCAGTGAGCCAG GAGACCTAGAAATGCCACC

AACCCATCTAATCTTACCAAGGCAGCATTCTGCAGTGAGTTCATTACACATGGGATTTCAGACATTTCCGTTTTCTGCTACATGTAAAAT TAATTTGCT

TAGTGCTGGAGAATCAGCTAATAAATATTGTATGCTGTGGCAACTGGGAGGCTGCAGAAACTCTTGGGTCTCGTTCTTGCTTACAG TTCCAAGATTTCA

AGAACCCAGCAGTCAATATTCACTTGCAGATATGAGGAACATCTTTTCTGTCAAAGGAGACAGCCTTGTGATTAACCCTGCAAAAGCAAAGGGGTGGAGA

CAAGCACGACTACATCCAATAATGGCTGAAACGCTGGCGCATCTGAAGGCGTATTTGTGTCATAATGGTCTGTCTTCTCAGGAGACTAAGCTGGAGATCT

TTCTGCCTACAAAAGTGTTTCAGCTGGAGTGTAAGTGCAGAAGTGAGCTTGTGTGACCACTCATATGAGATGTCCAATACCCATTTCTCCTCAGTGATTA

GGAAACTGGTAACAAAGGCTTAGCGTTCCCAGTATGCCTCTGTTCTGCCAACTCATGACTTTAGGCCTTCCTGGGCTCTATTGTCTTCTTAGAAAAAATA

TTGCAGTTTTATTAGCTACCCTAAAATCCTATTCTGCCTAAAATTTTACACTTACTTTAAAACTTTCTAGCCATTTTAATAATAACTATATGTGCATACC

CTTAAAACTTAGTTTCTCCAGTAAGTAGTAAGTTTCTGTTATAAAGGATTTGAGAAGCATAGTTTGAGAAAAGCAGTTTGTTATAGAAAGTAAATAAAAG

TGAGCTTCAGGTATTATCTAATTGTAAATGAGCTTTAGGTTTTCTCATTTGGAAACTGGCCTAAGGAGATAAGGAATTGAGACTCGGATCAGCACGGCGT

TCTGGGAGAATAAAGGCTCAGAGTTCTGTTGGGAGGAAAAAGGATAGAGTACAGCAAACACACGGGAGTCCATCCCAACCCTGAAGGACTCACGGTGCAG

TTAAGGACATTGAAGGGTCAGCCCTCATCAAAGGAAGTCTCCTTGACCATTACAGAACTCCACTGCTGAGCCAAAAGGACAGGTGACTACATGGTAGGTG

TCCAGTCCTAACTGACTTACCCAAGATGCCTGAGCCTCAGAGATCATAATGGGAGGGCTTGGGACTTGACGGAGATCATATAAGAACCAGAGGAACAAGT

TTGCTGTGAGACTGTGTCTCCAAGAAACTGTCCATGAAGTTTTACCAACATGGCTTCTTAAACAAGACCTGGAAAAGAATGACAGCAATAGCATGCTAAC

ATGGAAGGGGCAATCTCCTGAGGCTTCAACCCTGCCCAGAACTCAGGAACTAAGGCGTGCTGGAGGTGGGAGAAGAGGGAAGATCTTCCTCCTCAAGCTG

GTTCTACAGTACCAAGTGGTCAGCCATGCAATCATATACACAGAAGTAAAGTTATATGGACTGAGCATGTTGTGTCTATGTACTTGGCGGGGGGGGGGGG

ATAATGATGTAATTGCATTTTTATTTCAAAAATAAAAATAGTAGAAGAG
Translation
 MEDNSVLEQWRTRFCVEGVPEK KKTVTGVMINGTFEEIVPSSNPNSPPGIENDKLFPSKDYVDDFIPVKCSLYYPGVKAEHQG GLLIDEEMIFMNKA

MDNHLPTVNGLLSRLKLYLVKDPFLDFKEELSGKDNFT TEYFSVQECSEPFVRDFHMAEETFCKKKL PSVFPSGFKSLISTNPKQEILILPPSKLKKP

LNSIPKIMDSVDESECFKGD DITSKHEFDTEDIKCNSTENLTFASLCEPECSEPG GDLEMPPTHLILPRQHSAVSSLHMGFQTFPFSATCKI INLLS

AGESANKYCMLWQLGGCRNSWVSFLLTV VPRFQEPSSQYSLADMRNIFSVKGDSLVINPAKAKGWRQARLHPIMAETLAHLKAYLCHNGLSSQETKLEI

FLPTKVFQLECKCRSELV
Transcript ENSMUST00000107548
Sequence
ATGGCATTGAACGGAAGAACTATGTTTCCAGCCTTCAAATATTATGCAATAGACTATTTACAAGAG GACATAATTAAAGAGAGGCTTTACAGAGATGCT

TTATTGCTTCAGATTCCTTCATGTTTAAATCAAGATAAAAACATTATTGATGATAAATATAGGACTCCATGGACAAGAG CTATTCCAGTTCAGGAAATG

GAAGATAATTCAGTCTTGGAGCAGTGGAGAACAAGATTCTGTGTGGAGGGTGTTCCTGAGAA AAAGACAGTTACAGGAGTGATGATTAATGGCACATTT

GAGGAAATTGTTCCAAGTTCCAATCCAAACTCTCCACCTGGAATAGAGAACGATAAACTGTTCCCCAGTAAGGACTACGTAGACGACTTTATTCCTGTCA

AGTGTTCCTTGTACTACCCCGGAGTGAAAGCGGAGCACCAAG GATTGCTTATTGATGAGGAAATGATTTTTATGAATAAAGCAATGGACAACCATCTAC

CAACTGTGAATGGTCTCCTGAGCAGACTGAAGCTCTATCTGGTGAAGGATCCATTTTTAGATTTCAAAGAAGAGCTCTCTGGAAAGGATAATTTCAC GG

AGTATTTCTCTGTTCAAGAATGTTCGGAACCTTTTGTGAGAGATTTCCATATGGCTGAGGAGACCTTTTGTAAGAAGAAACTA CCATCAGTTTTTCCTT

CTGGGTTTAAATCCTTGATATCTACAAATCCCAAACAAGAAATTCTCATTCTACCACCATCAAAACTGAAGAAACCATTAAACTCGATACCGAAAATAAT

GGACTCTGTAGATGAAAGTGAATGTTTCAAAGGAG ACATTACTTCCAAGCATGAATTTGATACTGAGGATATAAAATGCAACTCCACAGAAAACTTAAC

ATTTGCAAGCCTTTGTGAACCAGAGTGCAGTGAGCCAG GAGACCTAGAAATGCCACCAACCCATCTAATCTTACCAAGGCAGCATTCTGCAGTGAGTTC

ATTACACATGGGATTTCAGACATTTCCGTTTTCTGCTACATGTAAAAT TAATTTGCTTAGTGCTGGAGAATCAGCTAATAAATATTGTATGCTGTGGCA

ACTGGGAGGCTGCAGAAACTCTTGGGTCTCGTTCTTGCTTACAG TTCCAAGATTTCAAGAACCCAGCAGTCAATATTCACTTGCAGATATGAGGAACAT

CTTTTCTGTCAAAGGAGACAGCCTTGTGATTAACCCTGCAAAAGCAAAGGGGTGGAGACAAGCACGACTACATCCAATAATGGCTGAAACGCTGGCGCAT

CTGAAGGCGTATTTGTGTCATAATGGTCTGTCTTCTCAGGAGACTAAGCTGGAGATCTTTCTGCCTACAAAAGTGTTTCAGCTGGAGT CCTGGCTAGAA

CTTAAGAGTCGTCCCTTGCCCATTGTGCCAATCAGTGAGAAATCTACAGATGTTCACCAGTTACATCCACAGAAGAGACCAATACCCTCTTCAGAAAAGG

AAGTACCACACCTTTGTTTGTCCGGTGAAAGTATCTCTGTTAAAAAATCCAAAGTAGAAGCAAACCCAAAGAATGATCAAGAACCAGAAGCTAGAATAAT

GCAGAAGCCGGAGAACAGCTGTGTTGGACTTGGCTGTTCAAGTCAAGTGCCATCTGCTGAATCAGCTTCCTCTTCCCAGATCCAGGCATCTTATGATAAA

AAACAAGATGATTTGGACCTTCTGAGCGAGTTTATTATTCTGAGAAGTAAACACCAGACTTTCCCTTCAGAAGCTGACGTCGATGTCAAAAGCCATGACC

ATGACCAAAACAATG AATTTCAAGATAAAGAAAAATATTCTTTGACTCTTCAAGAAGAAAGTCTTGTTGCTTCTAATAGTAAAGCTCCAGAGGAGAGAT

GTGAAGAAAGGACAGATGGCGTCATCGAGATCCCCGCTTCAG ACACCCAGTGCCAAGCATACTGTCTCCTAGAAGCCACAGCGAATCCTATCTTAAAGG

AGCTTGTTTGCCTCTGTACTTACCCTGCAGCCAATTGGAAATTCGCCACTGTCAATTTTGACCAAACAAGATTCTTCTTAAAGGAACAAGAAAAAAAGAT

AAATGATGCTACTCACCCCG ATAAAAATGATGACAGAAAGATGACATTCAGGCATGCTGCTCTCTTACATCTCCTGATAACAATTAGAGACGTCCTTTT

AACATGCAACTTGGATACTGCATTAG GATATTTGTCAAATGCAAAAGATATCTACAAAAGTGTGTTAGACTCCCGTTTGGATAACATTTGGAGACAGCT

GAAAATTTTACAGTTTATTAAGGAAAAAAGGCCTAAAAGCAACTATAAGATCCAAGAATTGCAGTGTCAAATACTAAGTAGGCTACAGAATCAACAACAA

ATGAAG GTACTGATTATAATAAGAATGGACTCAGATGGAGAAAAGCATCTGCTTATTAAAACACTTAAGAAAATAGAAG GTTTAACAATGACTGTTTT

ACGTTCTAATGATAGAAAAAAAATTCTGGAAACTACCAGTATTTTAAAAGG TACGAATGCCTGCGTGGTTGTGCACAACCACAGTATCGGAGCGGATTT

CCCCTGGAGCAGCTTCTCGCTCGTGGTGGAGTACAACCATGTGGGGCACTCTTGCTGGGCCGAGCACTGCCAACTGTTGGATATACCTTTTCTGGCCTTT

AAAGTCGCTGTTCCAGACACAGCTCTGCAGA GAGATGCCTTGCTGGATGGATTTGGTGGGTTTCTCTTGAAAATTCCCATTCCATATGTATTTTTTGCA

TCTGAAGGACTTCTCAATACTCCAGAGATACTCCGGCTGCTGGAGTCCAA CTATAATATCACACTAGTGGAGAGATGCTGCTGTGGGTCACTGAAACTC

TTTGGAAGTACAGAGTGCTATGTGGTGGTGACAGTCGACGAGCATACTGCTATAGTTGTGCAG GACCTAGAAGAGTTACATCATGAGAAGGCATCAGAC

AATATCATCATGAGATTAATGGCACTGTCGTTCCAGTATAGCTGTTGCTGGATAATACTATATTCCAAGGAAACACTAAATTCACA ATACCATCTTACA

GAAGAGACACTTCGTCACCTCGCACAGGTTTATGCAGCTCTGGTTTCCTCGGGCCTGAAATCTGAAGAGCTGGATGTAAAG CTTATAATTGCCCCTGGA

GTAGAAGAGACTGCTTTAATAATTCGACAAATTGCAGACCACAATTTAATGACGTCGACGAGAGATCCCCATGAATGGTTGGATAAATCCTGGGTGGAAG

TTTCACCTTCTAAG GAGGAAATGAGCCTACTTGATTTTCCCTGTATAAACCCACTGGTGGCTCAGCTCATGTTACACAGGGCGCCTTCGCTGCACTGGC

TCCTGATAGCAACGCCTGCTGAGCTCCAGGAACTCCTGCCCCAGGTTCCAGGCAAAGTACTGAAG CATTTTTGCAGCATCACTTCCTTGTTCAAGATTA

GTTCTCCCTCCATGACAAAGTCTTCTCAGATTTCATCACTTCAGGAAGATATGAATCAAACTGATCTCTTTATTTCTCAGAGTTCAGCTCCTATCATTCA

AGAACAGGAGGAATATTATCCCTATGAAGACTCGGAAGGCACAAGCTCTTCTCCTGTGGAGCTAAGAGCAACTCCATGCATGCTGCCATCTGCAGCACCG

CACAGTCAGAGGGGCTGCTGGGAGGACCCCAGCTGTGGCCCTGACCCCGTGCAGAATAACCCTTCCCTAATGAATGCAGAATCAAAGAAAGTCACCTGGC

CCTCCGTTCCCAGCTGGAGTGATTCAGAATCAGATGTCTTTTCTCTGGCCCGAACACAAGTAAGTTGTGAACCCATAATGACACTAACTGATTCTCAAAG

GAGAGGCACAAATGGTTTTGTAAATTGTCCCGAAGCCAAAGGACCCAGAAACATGCAAGTGTCCACCCCTGTCTTTTTACCAGAGAACTCCCAGTCCCAC

CTTCACTGGGACTTTAAGAAAAACAGTTGTAGAAAACAGATTTACTCGTTCAATCCAAGCTGTGGAACAGAACAGACTACTTACAACAAATGGTACTCTT

GGAAAGATGACTTCTCCAGTAATCAGCCCGAGTGTCTGTGGGATGAGATGGAAGATGTCACATACAGAAATGCAAATGCTGGGACCCGGGAGACTTTTTG

GAGAGAACTGCCAGCTGTTCCAAGTTGGGATTCACCCTGTGCTTCTGATTCTAATGCAAATCAAAGAGGGTTCAAGGGCCTTGATTTCTGCCAAAGAGCT

GGAAACTACTTAGGACAGAGAAGCCTCCCTGTGTCTTCATCTAATTGGGGAGATTACAAAACACCAACAG - UNI28519 - ACTTAATGTACTCACA

AGTACCACAACCCAAGAAACGACGTCTAATGTATGAGAAAGTCCCTGGAAGAGTGGATGGGCAAACCCGGCTGAAGTTTTTATGA
Translation
MALNGRTMFPAFKYYAIDYLQE DIIKERLYRDALLLQIPSCLNQDKNIIDDKYRTPWTRA AIPVQEMEDNSVLEQWRTRFCVEGVPEK KKTVTGVMI

NGTFEEIVPSSNPNSPPGIENDKLFPSKDYVDDFIPVKCSLYYPGVKAEHQG GLLIDEEMIFMNKAMDNHLPTVNGLLSRLKLYLVKDPFLDFKEELSG

KDNFT TEYFSVQECSEPFVRDFHMAEETFCKKKL PSVFPSGFKSLISTNPKQEILILPPSKLKKPLNSIPKIMDSVDESECFKGD DITSKHEFDTED

IKCNSTENLTFASLCEPECSEPG GDLEMPPTHLILPRQHSAVSSLHMGFQTFPFSATCKI INLLSAGESANKYCMLWQLGGCRNSWVSFLLTV VPRF

QEPSSQYSLADMRNIFSVKGDSLVINPAKAKGWRQARLHPIMAETLAHLKAYLCHNGLSSQETKLEIFLPTKVFQLES SWLELKSRPLPIVPISEKSTD

VHQLHPQKRPIPSSEKEVPHLCLSGESISVKKSKVEANPKNDQEPEARIMQKPENSCVGLGCSSQVPSAESASSSQIQASYDKKQDDLDLLSEFIILRSK

HQTFPSEADVDVKSHDHDQNNE EFQDKEKYSLTLQEESLVASNSKAPEERCEERTDGVIEIPASD DTQCQAYCLLEATANPILKELVCLCTYPAANWK

FATVNFDQTRFFLKEQEKKINDATHPD DKNDDRKMTFRHAALLHLLITIRDVLLTCNLDTALG GYLSNAKDIYKSVLDSRLDNIWRQLKILQFIKEKR

PKSNYKIQELQCQILSRLQNQQQMK VLIIIRMDSDGEKHLLIKTLKKIEG GLTMTVLRSNDRKKILETTSILKG GTNACVVVHNHSIGADFPWSSFS

LVVEYNHVGHSCWAEHCQLLDIPFLAFKVAVPDTALQR RDALLDGFGGFLLKIPIPYVFFASEGLLNTPEILRLLESN NYNITLVERCCCGSLKLFGS

TECYVVVTVDEHTAIVVQ DLEELHHEKASDNIIMRLMALSFQYSCCWIILYSKETLNSQ QYHLTEETLRHLAQVYAALVSSGLKSEELDVK LIIAPG

VEETALIIRQIADHNLMTSTRDPHEWLDKSWVEVSPSK EEMSLLDFPCINPLVAQLMLHRAPSLHWLLIATPAELQELLPQVPGKVLK HFCSITSLFK

ISSPSMTKSSQISSLQEDMNQTDLFISQSSAPIIQEQEEYYPYEDSEGTSSSPVELRATPCMLPSAAPHSQRGCWEDPSCGPDPVQNNPSLMNAESKKVT

WPSVPSWSDSESDVFSLARTQVSCEPIMTLTDSQRRGTNGFVNCPEAKGPRNMQVSTPVFLPENSQSHLHWDFKKNSCRKQIYSFNPSCGTEQTTYNKWY

SWKDDFSSNQPECLWDEMEDVTYRNANAGTRETFWRELPAVPSWDSPCASDSNANQRGFKGLDFCQRAGNYLGQRSLPVSSSNWGDYKTPTD - UNI28

519 - DLMYSQVPQPKKRRLMYEKVPGRVDGQTRLKFL

For any suggestions or comments, please send an email to unitrap@crg.es