Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038602 (Slc35f1)
Chromosomal location
Chr 10: 52410803 - 52831188 (+)
Description
solute carrier family 35, member F1 Gene [Source:MGI (curated);Acc:Slc35f1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35489
Vector Insertion
Chr 10: 52653074 - 52740220
Public Clones IST14652C12 (tigm) IST10378G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047026
Sequence
ATAAGACAAG GAGAAGAAAACCTCCTGGCAATTTTACGACGAAGATGGTGGAAGTATATGATCCTTGGACTCATAGACTTGGAAGCTAATTACCTGGTG

GTCAAGGCTTACCAGTACACAACTCTGACCAGTGTCCAG CTCCTGGACTGTTTTGTGATCCCGGTGGTGATTTTGCTCTCCTGGTTCTTCCTGCTGATC

CGGTACAAGGCTGTGCATTTCATCGGCATCGTAGTCTGCATCCTGGGTATGGGCTGCATGGTGGGAGCGGATGTGCTCGTGGGAAGGCACCAGGGAGCAG

 GAGAAAATAAGCTGGTAGGAGACCTTCTGGTCTTAGGAGGAGCCACCCTGTACGGGATCTCAAATGTCTGGGAAGAATCCATTATCCGAACCCTGAGCC

GTGTGGAGTTCCTGGGAATGATTGGTCTCTTTGGTGCATTTTTCAGTGGAATTCAATT AGCCATCATGGAACACAAGGAACTGTTAAAGGTACCATGGG

ATTGGCAAATAG GACTGCTCTATGTTGGCTTTAGTGCCTGCATGTTTGGTCTCTACAGCTTTATGCCAGTTGTCATAAAGAAAACGAGTGCCACCTCGG

TCAACCTTTCTCTGCTCACAGCAGATCTGTACAGCCTGTTCTGTGGACTCTTTCTCTTCCACTACAAG TTTTCAGGTCTTTACCTCCTGTCTTTCTTCA

CCATCCTCATCGGGCTGGTGCTGTATTCCTCCACCTCTACATACATAGCCCAGGATCCCCGAGTGTACAAGCAGTTCCGCAATCCTTCAGGACCTGTCGT

GGACTTACCCAGCACGGCTCAGGTAGAGCCTTCAGTCACCTACACCAGCCTGGGCCAGGAGACAGAAGAAGAGCCCCATGTACGTGTGGCCTAGGGGAAG

ACCTGCCCTGCCCACTGAGGACAACTCAGAGGCCATGTGTTTGCCCATCATCTGTATTGTACATAGAGAAAGGTATTTAGTAGGTGCAGTTTCACAGGTG

GACTGCAAGGTAGCTAATCCTTTCATCAAAGGAAGAAGCTGAAGACCACTGGAGACTCAGGCTTCAATCCACCTGACTCAGAGAGAGGTTTTGATAGTGT

GTATCCTGACCCAGTCCCCACCCCTCCATTGATTACTGTGAAAATTTTTGAATCAAAAACAAGTATCATTGTTACTATGATCTTTATTATTAATTGTTAC

TGTTATTACACGACTTTC
Translation
IRQG GEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTTLTSVQ LLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQ

GAG GENKLVGDLLVLGGATLYGISNVWEESIIRTLSRVEFLGMIGLFGAFFSGIQL LAIMEHKELLKVPWDWQIG GLLYVGFSACMFGLYSFMPVVI

KKTSATSVNLSLLTADLYSLFCGLFLFHYK FSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPSTAQVEPSVTYTSLGQETEEEP

HVRVA
Transcript ENSMUST00000105472
Sequence
TATATATATATGCATATATATTATACAT GTGCTCTGAATATAAGACAAG GAGAAGAAAACCTCCTGGCAATTTTACGACGAAGATGGTGGAAGTATAT

GATCCTTGGACTCATAGACTTGGAAGCTAATTACCTGGTGGTCAAGGCTTACCAGTACACAACTCTGACCAGTGTCCAG CTCCTGGACTGTTTTGTGAT

CCCGGTGGTGATTTTGCTCTCCTGGTTCTTCCTGCTGATCCGGTACAAGGCTGTGCATTTCATCGGCATCGTAGTCTGCATCCTGGGTATGGGCTGCATG

GTGGGAGCGGATGTGCTCGTGGGAAGGCACCAGGGAGCAG GAGAAAATAAGCTGGTAGGAGACCTTCTGGTCTTAGGAGGAGCCACCCTGTACGGGATC

TCAAATGTCTGGGAAGAATCCATTATCCGAACCCTGAGCCGTGTGGAGTTCCTGGGAATGATTGGTCTCTTTGGTGCATTTTTCAGTGGAATTCAATT A

GCCATCATGGAACACAAGGAACTGTTAAAGGTACCATGGGATTGGCAAATAG GACTGCTCTATGTTGGCTTTAGTGCCTGCATGTTTGGTCTCTACAGC

TTTATGCCAGTTGTCATAAAGAAAACGAGTGCCACCTCGGTCAACCTTTCTCTGCTCACAGCAGATCTGTACAGCCTGTTCTGTGGACTCTTTCTCTTCC

ACTACAAG TTTTCAGGTCTTTACCTCCTGTCTTTCTTCACCATCCTCATCGGGCTGGTGCTGTATTCCTCCACCTCT
Translation
YIYMHIYYTC CALNIRQG GEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTTLTSVQ LLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILG

MGCMVGADVLVGRHQGAG GENKLVGDLLVLGGATLYGISNVWEESIIRTLSRVEFLGMIGLFGAFFSGIQL LAIMEHKELLKVPWDWQIG GLLYVGF

SACMFGLYSFMPVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYK 
Transcript ENSMUST00000105473
Sequence
ATGATTCCCCCCGAGCCTCCGCAGCCCCAACTGCAGCCACCACCTCCACCGGCCCCGCCGAACCATGTGGTGACCACCATCGAGAACCTGCCAGCTGAGG

GCAGCGGCGGCGTGAGCCTGTCCGCCTCCTCCCGGGCTAGCATGCGCCAGAGGATCCGCAAAGTGCTGAACAG GGAGATGTTAATCTCTGTGGCTTTGG

GTCAAGTGTTATCCCTTCTCGTTTGTGGAATTGGCTTGACGAGCAAGTACCTGGCAGAGGATTTTCATGCGAACACACCAGTCTTCCAGAGCTTTCTGAA

CTACATCCTCCTCTTCTTGGTATACACCACCACCCTAGCTGTCCGACAAG - UNI35489 - GAGAAGAAAACCTCCTGGCAATTTTACGACGAAGAT

GGTGGAAGTATATGATCCTTGGACTCATAGACTTGGAAGCTAATTACCTGGTGGTCAAGGCTTACCAGTACACAACTCTGACCAGTGTCCAG CTCCTGG

ACTGTTTTGTGATCCCGGTGGTGATTTTGCTCTCCTGGTTCTTCCTGCTGATCCGGTACAAGGCTGTGCATTTCATCGGCATCGTAGTCTGCATCCTGGG

TATGGGCTGCATGGTGGGAGCGGATGTGCTCGTGGGAAGGCACCAGGGAGCAG GAGAAAATAAGCTGGTAGGAGACCTTCTGGTCTTAGGAGGAGCCAC

CCTGTACGGGATCTCAAATGTCTGGGAAGAATCCATTATCCGAACCCTGAGCCGTGTGGAGTTCCTGGGAATGATTGGTCTCTTTGGTGCATTTTTCAGT

GGAATTCAATT AGCCATCATGGAACACAAGGAACTGTTAAAGGTACCATGGGATTGGCAAATAG GACTGCTCTATGTTGGCTTTAGTGCCTGCATGTT

TGGTCTCTACAGCTTTATGCCAGTTGTCATAAAGAAAACGAGTGCCACCTCGGTCAACCTTTCTCTGCTCACAGCAGATCTGTACAGCCTGTTCTGTGGA

CTCTTTCTCTTCCACTACAAG TTTTCAGGTCTTTACCTCCTGTCTTTCTTCACCATCCTCATCGGGCTGGTGCTGTATTCCTCCACCTCTACATACATA

GCCCAGGATCCCCGAGTGTACAAGCAGTTCCGCAATCCTTCAGGACCTGTCGTGGACTTACCCAGCACGGCTCAGGTAGAGCCTTCAGTCACCTACACCA

GCCTGGGCCAGGAGACAGAAGAAGAGCCCCATGTACGTGTGGCCTAGGGGAAGACCTGCCCTGCCCACTGAGGACAACTCAGAGGCCATGTGTTTGCCCA

TCATCTGTATTGTACATAGAGAAAGGTATTTAGTAGGTGCAGTTTCACAGGTGGACTGCAAGGTAGCTAATCCTTTCATCAAAGGAAGAAGCTGAAGACC

ACTGGAGACTCAGGCTTCAATCCACCTGACTCAGAGAGAGGTTTTGATAGTGTGTATCCTGACCCAGTCCCCACCCCTCCATTGATTACTGTGAAAATTT

TTGAATCAAAAACAAGTATCATTGTTACTATGATCTTTATTATTAATTGTTACTGTTATTACACGACTTTCAGAAGGTTTTTTATTCCTGATGGGAATTA

TTACCAGACCCTCACCTGCTCAACATAAATCCCACTTTTCTATGGCAAGTCACTTTTTAAGAATCATACTTTTTGTTTGTTTGTTTGTTTGTTTGTTTTG

CACAGACTATGTGAGTGATGCATGCCACAGAAGCTTGCCCATCCTGGTGACCTTGTGGCTAATGGTGTCCTCTGTCACCTGTTGGATTGCCTGTTCGATG

AGGATTTTGTGCTGTGACCCTTGTAGGGAGGGGAAACTGACCATACAATTCTCTATTCTAGGAATAGATATAAAACGAACATTATAGCCATTTTATATTT

CATTTTCTGCTTATTCCAGGCCACTGGCTTTCTGCTGGCCTAGGAGATTCATCTAACCAAGCCCTGTAACTACATGATAGATAGGATAGAGACTGTCCCA

TTTTTGCCACTTAAAGAAACCCTAGAAATATGGGTTATATTTAGGGTTATATGTTTTTAATTTCTTTTTCTGTCTTTCTTTATATCGATCTCCTCAAAAA

TTAGTTTTTATTTTCATTTTTGTTCATAATGATGTCATGGAAATTAATCAAGGGACTGGAAAAGCCATGACTTTCACCCTCTTATTTACCTTTCTGGAAG

TATGCCAACATGGAAATTATCTTTATTGTGGAGTCCCACTGTTCGTCCCACCTCTTTGAGTCAAGGTACTAGTATGGAGAAATCTCTGTTAGTAGCTCGT

GCTCTGGTCACTTAGCGATAAAAATGTCACCATTGAAAAGTCTGGCACTTTGATCACACTCAATACCCACCTAATAGTAGAATATAAGGAAAAGCAACTC

TACGCACAAAGAATGCTACAGCATCCCAATAAAGCTTAATACATCACTAGTTTAATCAGTTGTCTTCAAGAATATTTCCCCCACACCCACCCCACTCCAA

ACACAGAAAATTAAGAAATACCACAAACCTTTATAATGTAGAAAAATTTCACGTGTCAGTGTGAAAGTTCTCTGTAGCTTGGCTGACTTCAATACCATTC

AAATGGATCCTTGATGGAGTTACAGGGTTTGTATAAATGTTTATGTAATTTGAGGCAATTCAAGTCAACATATTTTAAGCAAGCAAGCAAAACAAAACAC

TTGTGGGAGGTGGGGGTCTCTCATAAAGTAAGACCAGATTGCAAAGTAGGACCTCAACAAGTCATAAACATGGCTGGCAGAAGCTCTTCGGCTGTCTACC

AGACTCTTTGCCTGCCTTCTTCTGTGAGCTATTTTGATAAGTCTTATGAGAACAGCACATACACAAAATAAGGAATGCGCTTGAACACTGTAACTCAGTT

TTAGGTTTTTTTCCATCGAAAAATATAACATTTCCCTCTAACATATTGTTTAGTCCTGTCCTAGGAGATAGAAAATAAAACTATTTTCCTGGTGTGCAAA

TTTCACATCAGTTCAACTCCTTTGAAAATAGGTTTTCTTTATTAGGGTGGAGTGGGCAGGGGCAAGAAAGGTTTGTGCTAAAGCTACATCACATAATAAC

CTTGCAAATATCTGCTCTGTGCTACCTTTTAAGCCAATTAAATATCTTTCTCTGAATATTTTGTCCATTCAGATCTGAAGACCCTTAATGACTGTGGTTT

TACTTTTATGTTTACATTCCTTCAGTTTGCATAATTTACTTGATTTATTGCATTTTTAGTATTTATTTTAAGCCAAATGTCTTTGTCTTTTTTATTCATT

TTTATGACACTAATTTGTAGACACTCTGTAAACTCTAATGAGAAACAAATGGCTGAGATTATTTCCAAGTCCATTCAGTAGGCTGGGAATAATTTTAAAG

TTACATTTTGAAAAGGTTTGCAATTAATTGATGGCTAAAGATGGCTGTCTGGACCATTTCATAGGATGAAATTGACTCCATTGTATGGAAACCAAATGTG

AATATCAGGATGAACTCATTGTATACTTTTTGTCATCCAGTGTCTTTGTGATCAGACATTAATGCACCTGTGTTGGTTTATCTCCATTCATGAAGCTGGT

AACATTGGCTCATCCAAGACTAGGAGTTTAGGATTGACCCTTAAGGGAAAAAGACAAAAAGTTGCAAAGAAAAATGTTTTTAATCTGAAAGCATTGGTGG

TTTGACAGCGGGGCGGGAAGTGGGAATAGGGTAATAGTAACTGTAGCAGTTTTAGTTTCTGAGATTCCGTAACCTCAGTAGACACCAGCAAGAATTCCGG

CATTTTAATCTACCACTCTTCTCACCTCAAGCAAGAACAGTCCTCTGTATGAAGTTGATAAGAAGCAAACCACAGCTCTCTTAAACCCTACCAGAGATGA

GTGGTGGTTTTCACTTTCTCGGTGGAGACTTTCACTGAGGACAGAGCTTGCCTTGGTCAGACCTACTCACAGCTTCGAACACATATACAGGTAGACCAAG

AAATGGACAAGTTCGCACCACTGTGTCCCATGAAGATATTTCAATGTTTAGTTTAGGTATTGCTAACTTGTGGTATTAACCTTCTGACAAGCTTGTAGTA

TTGTTTGATTGGCATTTATTTTTGATTTGTAACCATTTAGTAGTTCCCAGCTAGCTATCAGTGCAGATTTTACCCCATGGGTAGGAGTCTATCTTCACAC

CACATAACAAAGCACACTAATCCTGACACCACGATGGGAAATATGAACCAAAATATG
Translation
MIPPEPPQPQLQPPPPPAPPNHVVTTIENLPAEGSGGVSLSASSRASMRQRIRKVLNR REMLISVALGQVLSLLVCGIGLTSKYLAEDFHANTPVFQSF

LNYILLFLVYTTTLAVRQG - UNI35489 - GEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTTLTSVQ LLDCFVIPVVILLSWFFLLIRYK

AVHFIGIVVCILGMGCMVGADVLVGRHQGAG GENKLVGDLLVLGGATLYGISNVWEESIIRTLSRVEFLGMIGLFGAFFSGIQL LAIMEHKELLKVPW

DWQIG GLLYVGFSACMFGLYSFMPVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYK FSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSG

PVVDLPSTAQVEPSVTYTSLGQETEEEPHVRVA

For any suggestions or comments, please send an email to unitrap@crg.es