Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038611 (Phrf1)
Chromosomal location
Chr 7: 148414683 - 148448650 (+)
Description
PHD and ring finger domains 1 Gene [Source:MGI Symbol;Acc:MGI:2141847]
RefSeq_peptide
NP_001074587.1 
UniGene
Mm.248656 
MGI
MGI:2141847 
Uniprot/SPTREMBL
Q3TPE7 Q3TPL9 Q3UVM8 Q505G1 A6H619 
Human Ortholog
ENSG00000070047 (PHRF1)
Omim not available
UniTrap UNI162
Vector Insertion
Chr 7: 148414791 - 148417125
Public Clones GC0155 (tigem) P015H04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34485
Vector Insertion
Chr 7: 148414791 - 148417125
Public Clones (sanger) 3SP124E10 (ggtc) IST14454C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5382
Vector Insertion
Chr 7: 148417125 - 148417242
Public Clones RRF365 (baygenomics) SYA144 (baygenomics) XH081 (baygenomics) YTA226 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10023
Vector Insertion
Chr 7: 148418317 - 148418441
Public Clones XC260 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15512
Vector Insertion
Chr 7: 148418441 - 148423395
Public Clones PST6507-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20794
Vector Insertion
Chr 7: 148423395 - 148423602
Public Clones not available
Private Clones OST352131 (lexicon) OST330028 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28108
Vector Insertion
Chr 7: 148442579 - 148442701
Public Clones not available
Private Clones OST39915 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106027
Sequence
GGGAGCGCGCGGCGACGGCGGCGGCGGCTGACCGGCCTACTTGCGGTCGTGTTCGGACAGAGGCGGGATCGTCTAGGAGCGTCCGGGAGGCGCGAGGTTC

CCGG - UNI162 - - UNI5382 - - UNI34485 - AGGTGAACTCCAATGTGCAGCCATGGATGACGACAACTTGGATGAGCTTGTGGCGCACA

GCCCTGGGCCAGATGGACCCCCACGGGTTGGCTCCTCAGAACTGGCCAGTGATGCTG - UNI5382 - - UNI10023 - AAGAAAGCAGCAATGGC

CAAAGTGGAGACTCTGAAGATGATACAGGCAGTGAGCAGGATGATGACACAGATGGGGAGGAAACAGAGGGGCTGTCTGAAGAGGAAGACCCAGAGGATA

GATCTG - UNI10023 - - UNI15512 - - UNI20794 - GTTCTGAAGACTCAGAAGATGGAGTAGAAATGGCAACGGCAGCAATAGAGACTC

AAGGGAAGCTTGAAGCTAGCAGTGTACCCAATTCTGATGATGATGCAGAGAGCTGCCCCATTTGCCTCAATGCATTTAGAGACCAGGCTGTGGGCACCCC

AGAGACCTGTGCCCATTATTTCTGCCTGGATTGCATCATCGAATGGTCCAGG - UNI20794 - AATGCCAACTCCTGTCCTGTTGATCGAACAGTAT

TTAAATGTATTTGTATTCGTGCCCAGTTTAATGGTAAAATCTTAAAGAAG ATTCCAGTAGAAAACACTAAAGCTTGTGAGGCTGAGGAGGAAGACCCGA

CTTTTTGTGAGGTGTGTGGCAGGAGTGATCGTGAGGACCGGCTCCTACTGTGTGACGGCTGCGATGCTGG GTACCACATGGAATGTTTGGACCCGCCTC

TCCAGGAGGTGCCTGTGGATGAATGGTTCTGCCCAGAGTGTACGGTCCCTGGTGTGGATCCCACTCATG ATGCAGCTCCTGTGAGTGATGAGGAGGTCT

CCTTGCTACTGGCTGATGTAGTACCTACTACAAGCAGGCTTCGGCCTCGAGTAGGCAGGACCCGGGCCATCGCTAGGACACGGCAGAGTGAGAGAGTGAG

GGCAACTGTGAACCGGAACCGGATCTCCTCTGCCAGAAGGGTCCAG CATGTGCCAAGGTACCTCATGTCTTCTCTGCTGGATGAAACTATTGAGGCTGT

CGCCACTGGGCTGAGCACTGCTGTATACCAGCGTCCCTTGACACCTCGTGTCCCTGCAAAACGGAAAAGGAAGGCAG GGAGACGAAAGAAAGTGCTGGG

AAGAAAGAAAACTCGGTCCAGGTCATCTGTGAAAAGTAAGAGTGGGAGTACGAGAGCCAAGAAACGTCAGCACCGTGTAAGGAAGACAAAAGGGAGGAAG

CTGAAG AATGAAGTCACAGCTCGTTCTCGAATTGCACGAACACTAGGCCTCCGCAGGCCTGTCCGTGGCACCAGCATGCCATCAGTGTACAAGCCAGTG

GACCCCTCCCTCGGGCTGATGAGGGCAGACATTGGAGCAGCTTCCCTGTCACTGTTTGGAGATCCCTATGAGCTGGATCCTTTTGACAG - UNI28108

 - CAATGAAGAACAGTCTGCAGATCCACCTTCCCCTCTGAGTGCCAAGAGGAGAGTGCTGTCCCGCTCAGCTCTGCAGTCTCACCAGCCTGTGGCCAGA

CCTGTCGCCATGGGGCTCTCTAG GAGGCAGCTCCCTGCTGTGGCCCCAGAGCCCAGCGTGGAGGAGGCCCCCGTTCCTGACCTGTTGGGAAGCATCCTG

TCTGGCCAGAGCCTCCTGATGATGAGCAGTGCTGATGTTGTCATACACCGGGATGGCTCTCTCAGCGCCAAGAGGGCAG CTCCTGTTTCTCTTCAGCGA

AATTCTGTGACTCAATCCAGAGAAGAGTCCAGGCTCAGAGACAACCCGCAGCCTGGGGCACTACCCTCAGAGAGTGCATCTGGTGGATTCGTGGGAGACA

GACAACCAAACTCAGGGCTGAGCTGTGGGAATAGAACAGCTCTGTGCTGTCTCCCTGCCCGCATTGCCCAGACACCTGTGAGGTCAGATCCCTCACTGAC

TCCTCGCTCAGGTCTGTCTAGGACCCTTTCAGATGAGAACAGGCCCAGCCGGACACACAGCAGCAGCCCCCAACTCAATGGCTCCAATGTACGGGTTAGT

TCTGCCTCGACTAAGATCGTGACTCATTCTAGCTTTCCATCGAAAAATACAGCTTCTGGGCTTCCTCAGAGAACAGGTCCCAGGAGACCTGATTTCTCCA

AGCTACCCAGGATACCAAAGATCCATCGGGATGGCAATAAGAGCACGCAGGACCAGGCCCCAGCCAGCGGCCACATTGTCGAGCTCCCTAGCACTTGCAT

CAGCCGCCTGACTGGCAGGGAAGGCCCTGGGCAGCCAGGACGAGGCCGAGTCGACAGTGAGCCAAGCAGCAGGGGTCCCCAGGAGACTGGCTCACACACA

AGTGGTTCTCGACCTCCTGCGCCCAGCTCCCATGGCAGCTTAGCCCATCTAGGGCCCTCAAGAGGAAAGGGCATTGGGTCTAGCTTTGAAAGTTTCCGGA

TCAACATCCCTGGGAACACTGCACATTGCAGCCAGCTGTCCAGCCCTGGATTCTGTAACACGTTCCGGCCGGTAGACAGCAAGGTGCAGAGGAAGGAGAC

CCCGTTCCCCCTCTTCTCCATCAAGAAGCCGAAACAACTCAAAAGCGAAATCTATGACCCCTTTGACCCCACTGGCTCGGACTCTAGCCCTCCTAGCAGC

AGCCCAGAGAGTCTTGGTCCAGGCCTCCTACCCTCTGAGATCACAAGAACTATCTCCATCAACAGCCCAAAGGCCCCAGCCTTCCAGACTGTGCGCTGTG

TTACCTCCTACAGGGTAGAAAGCATCTTTGGGACTGAGATGGAACCTGAGCCCCAGCCCCCTAGTGAGCCTGTATCTGGCATGCTGGAGTTACTCAGCAA

GGGATCTGCTGAGGGAACCTCTGATTTGGAGCAAGAGGGACTAGGGGAAATAGAGCCTACAGAGATTCGGGGCTCCACAGCCCGGACACAGAGGCCACCC

CCACCAGACCCTTGGGATGATGAGGACGAAGTGTCCTGTACACCCTTCTTTGGCTCTGAGGAACGGACAGTGACGTGTGTGACTGTTGAGGAGCCAGGTG

TTCTACCAAGCCCAGATGCTCCACAGATCACCACCCACAGAATTGTGGAGTTCAGGGCCTCATCCCGTTCCCGCTCCACCTCCAGCTCCCGAAGCAGGAA

GAAAACGAAGAAGAAGAAGAAAAAGGTTGCCAGAGAGCACCAGAGGACACGCTCCAGCACTCGCTCTGGCTCCAGGGACAGGACTTCACGCTCAGTATCT

CCAGTTGCTGAGGAACACACCAGGAGGCACAGAGCCAAGACTAAGAGCCGGAGGTCTTCCAGTGACCGTGCCAGCAGCCAGGACAGAGCAAAGAGGAGGA

AGGACAGAGACGACAGAGACAGGGAGCATAGGCGGGGTTCCTGGGGTCATGGCAGGTGCCGGCGGAAGTCCAGGTCTCGCTCAGGGAGCCCTGGCAGTTC

TTCCTGTGAGCGCCATGAGAGTAAGAGACGGAAGAGGCGACATTCGGGGTCCAGGTCTCGGGGCAGCAGTCTGGAGAGGGACCGGAGACACAAACATCGG

GAGAGGAGCCGAGAGCGAATGGACAAGCAGGAGAGTGTGACCCGGTCCCGGGAGAGGAGGAGGTGGCGATCTCGGTCGCCTAGCTTGGAGCATAGGCCAC

GAAGGCCACCTTCCCGTGAGAAGCGTGCCCATTCCCCAGAGAAAAAGGGGCCTGTGAGGGAGGTTTCCCCAGCCCCTGCTACACAGGGGGAGTCGAGGCA

GGATGGAGACCACTCTGCTGAGCCTCCGGTTTCAGAAGTAAGTGTCTTGCCTGAGGTAGTAAGTGTCCTGCCAGAGGTGGTTGTGGCTGACCTGAACCCT

CCAGAAGTCCCTCCTGTCCTGGCAGAGCCAGTTGCCCATGTGCCTGAGGACCTGGACTATGGTGAGTCTGTGGAGGCAGGCCACGTCTTTGAGGATTTTT

CAAATGAAGCCATCTTCATCCAGCTCGATGACATGAGCTCGCCTCCTTCTCCTGAGAGTACAGACTCCTCCCCTGAGAGAGACTTCCCACCAAATCCCAT

ACTGCCCCCAGCCAGCCTTCCACAAGACAGTACTTTACCTACCATCCAAAGGGAGGTGTTACCCATTCACAGTGAAGATATCTCAAAGCCTGTGCCCCAG

GCCTTGGCCCCATCAGACCAGAGTCTGCTCAAGCAAGACACTGTAGAGATCACCACTACAACTCCCAGCACCCCAGCTGTGGTGCCCATGACAAAGGACA

GTCCGGTGCTGAGTGCAAGAGGATGGGAAGCAGTCAGGCCCAGGGATGCTGTGGCCCAGGCCCCACTGCTACGATCCCGAACCCTGGTGAAAAGAGTCAC

CTGGAACCTGCAGGAAGCAGAACACAGCACGCCAGCAGCCCTGGACAGAGATCCAA GGACACCACTTCAGAGGCCCCAGAGGCCCCAGGAAGGAGACTG

GGATGCAGAGGACAGGGCCCTCATAGGATTTCAGCAGGCACCATTCTCCGAGCTGCCCCCTCCCATCCACGTGCTCCAGGAGTCTGGGTTACCTGATGCA

GATCCCTCTCAG CCCCCTGGTGCTCCCAGGGCAGAAGGGCTTCCAGCTGCTGGGACTCTGCACTCAGCAGGGGGTATTCTTGCCCAGGTTTACAGCCCC

AACATGCCACCACCCTTGGCTCAGCCCTCAAGCATCCTGCCCTATGCACTGGTCAGCCAGCCCTCAGTCCAGTTGATCCTGCAGGGGACCCTTCCCCTAG

CAGGCTGCGGTACAGCACAGAGCCTGGCACCAGTGCCCACAATGCCAGCTACAGTCTCAGAGCTAGCTGTTCCAACCACCAACAACTCAGAAGAAAGGAC

TGCTACTCCCAAAACAGCTGCTGAGAAGACCAAAAAGGAGGAG TACATGAAGAAGCTGCACATGCAAGAACGGGCTGTGGAGGAGGTGAAGCTGGCCAT

TAAACCCTTCTACCAGAAGAGAGAAGTGACCAAGGAGGAGTACAAGGACATACTGCGCAAAGCCGTGCAGAAG ATCTGCCACAGCAAGAGTGGTGAAAT

CAACCCTGTAAAGGTGGCCAACCTGGTGAAGGCCTATGTGGACAAATACAGGCATATGCGCAGACACAAGAAGACTGAAGGTGGAGAGGAGCCACCCACT

CAGGGTGCTGAGACCTGAGGCTAGCCACTCTCTGGGGAGGCATCCCCAGCGGGAAAGAAATGGGGCCGCCAGCACTCCTGCCTCTGAGGGTCTCATGGTA

CCTGTCTGCACCTGTCTTGCTTATAATTGAAAACTGGACTTTTTTATATGTATATTATAGATACACTGTTTCCATTGTGTTCTAATTTATCAAAAATGGC

TTATGTTTAGAAACTTT
Translation
 - UNI162 - - UNI5382 - - UNI34485 - MDDDNLDELVAHSPGPDGPPRVGSSELASDAE - UNI5382 - - UNI10023 - EESSN

GQSGDSEDDTGSEQDDDTDGEETEGLSEEEDPEDRSG - UNI10023 - - UNI15512 - - UNI20794 - GSEDSEDGVEMATAAIETQGKLE

ASSVPNSDDDAESCPICLNAFRDQAVGTPETCAHYFCLDCIIEWSR - UNI20794 - NANSCPVDRTVFKCICIRAQFNGKILKK IPVENTKACEA

EEEDPTFCEVCGRSDREDRLLLCDGCDAG GYHMECLDPPLQEVPVDEWFCPECTVPGVDPTHD DAAPVSDEEVSLLLADVVPTTSRLRPRVGRTRAIA

RTRQSERVRATVNRNRISSARRVQ HVPRYLMSSLLDETIEAVATGLSTAVYQRPLTPRVPAKRKRKAG GRRKKVLGRKKTRSRSSVKSKSGSTRAKKR

QHRVRKTKGRKLK NEVTARSRIARTLGLRRPVRGTSMPSVYKPVDPSLGLMRADIGAASLSLFGDPYELDPFDS - UNI28108 - SNEEQSADPPS

PLSAKRRVLSRSALQSHQPVARPVAMGLSR RRQLPAVAPEPSVEEAPVPDLLGSILSGQSLLMMSSADVVIHRDGSLSAKRAA APVSLQRNSVTQSRE

ESRLRDNPQPGALPSESASGGFVGDRQPNSGLSCGNRTALCCLPARIAQTPVRSDPSLTPRSGLSRTLSDENRPSRTHSSSPQLNGSNVRVSSASTKIVT

HSSFPSKNTASGLPQRTGPRRPDFSKLPRIPKIHRDGNKSTQDQAPASGHIVELPSTCISRLTGREGPGQPGRGRVDSEPSSRGPQETGSHTSGSRPPAP

SSHGSLAHLGPSRGKGIGSSFESFRINIPGNTAHCSQLSSPGFCNTFRPVDSKVQRKETPFPLFSIKKPKQLKSEIYDPFDPTGSDSSPPSSSPESLGPG

LLPSEITRTISINSPKAPAFQTVRCVTSYRVESIFGTEMEPEPQPPSEPVSGMLELLSKGSAEGTSDLEQEGLGEIEPTEIRGSTARTQRPPPPDPWDDE

DEVSCTPFFGSEERTVTCVTVEEPGVLPSPDAPQITTHRIVEFRASSRSRSTSSSRSRKKTKKKKKKVAREHQRTRSSTRSGSRDRTSRSVSPVAEEHTR

RHRAKTKSRRSSSDRASSQDRAKRRKDRDDRDREHRRGSWGHGRCRRKSRSRSGSPGSSSCERHESKRRKRRHSGSRSRGSSLERDRRHKHRERSRERMD

KQESVTRSRERRRWRSRSPSLEHRPRRPPSREKRAHSPEKKGPVREVSPAPATQGESRQDGDHSAEPPVSEVSVLPEVVSVLPEVVVADLNPPEVPPVLA

EPVAHVPEDLDYGESVEAGHVFEDFSNEAIFIQLDDMSSPPSPESTDSSPERDFPPNPILPPASLPQDSTLPTIQREVLPIHSEDISKPVPQALAPSDQS

LLKQDTVEITTTTPSTPAVVPMTKDSPVLSARGWEAVRPRDAVAQAPLLRSRTLVKRVTWNLQEAEHSTPAALDRDPR RTPLQRPQRPQEGDWDAEDRA

LIGFQQAPFSELPPPIHVLQESGLPDADPSQ PPGAPRAEGLPAAGTLHSAGGILAQVYSPNMPPPLAQPSSILPYALVSQPSVQLILQGTLPLAGCGTA

QSLAPVPTMPATVSELAVPTTNNSEERTATPKTAAEKTKKEE YMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQK ICHSKSGEINPVK

VANLVKAYVDKYRHMRRHKKTEGGEEPPTQGAET
Transcript ENSMUST00000122143
Sequence
GCATCACAGGACCATCAGCCCAAAGGTGACACTATCCACAGTAAGCTGGCTAGAACATGCCACCTTGCTTACCCATAGGCCAGTCTGATAGGGGTATTTT

CTCAACTGAGATTTCCTCTTCTAAAATGACGCTAACTTATGTCCCAGTTGACATTTTAGCCAGCACACATCCCAAGTAGATCTTAGGCCAGTGGGTTTAC

TTTAGATTAGATACATGTCCTATGAATTGACCACTCAGATGTTGAGGGTATGTTCACTGACCAATATTTCTGTCTTCAGATTCCAGTAGAAAACACTAAA

GCTTGTGAGGCTGAGGAGGAAGACCCGACTTTTTGTGAGGTGTGTGGCAGGAGTGATCGTGAGGACCGGCTCCTACTGTGTGACGGCTGCGATGCTGG G

TACCACATGGAATGTTTGGACCCGCCTCTCCAGGAGGTGCCTGTGGATGAATGGTTCTGCCCAGAGTGTACGGTCCCTGGTGTGGATCCCACTCATG AT

GCAGCTCCTGTGAGTGATGAGGAGGTCTCCTTGCTACTGGCTGATGTAGTACCTACTACAAGCAGGCTTCGGCCTCGAGTAGGCAGGACCCGGGCCATCG

CTAGGACACGGCAGAGTGAGAGAGTGAGGGCAACTGTGAACCGGAACCGGATCTCCTCTGCCAGAAGGGTCCAG CATGTGCCAAGGTACCTCATGTCTT

CTCTGCTGGATGAAACTATTGAGGCTGTCGCCACTGGGCTGAGCACTGCTGTATACCAGCGTCCCTTGACACCTCGTGTCCCTGCAAAACGGAAAAGGAA

GGCAG GGAGACGAAAGAAAGTGCTGGGAAGAAAGAAAACTCGGTCCAGGTCATCTGTGAAAAGTAAGAGTGGGAGTACGAGAGCCAAGAAACGTCAGCA

CCGTGTAAGGAAGACAAAAGGGAGGAAGCTGAAG AATGAAGTCACAGCTCGTTCTCGAATTGCACGAACACTAGGCCTCCGCAGGCCTGTCCGTGGCAC

CAGCATGCCATCAGTGTACAAGCCAGTGGACCCCTCCCTCGGGCTGATGAGGGCAGACATTGGAGCAGCTTCCCTGTCACTGTTTGGAGATCCCTATGAG

CTGGATCCTTTTGACAG - UNI28108 - CAATGAAGAACAGTCTGCAGATCCACCTTCCCCTCTGAGTGCCAAGAGGAGAGTGCTGTCCCGCTCAGC

TCTGCAGTCTCACCAGCCTGTGGCCAGACCTGTCGCCATGGGGCTCTCTAG GAGGCAGCTCCCTGCTGTGGCCCCAGAGCCCAGCGTGGAGGAGGCCCC

CGTTCCTGACCTGTTGGGAAGCATCCTGTCTGGCCAGAGCCTCCTGATGATGAGCAGTGCTGATGTTGTCATACACCGGGATGGCTCTCTCAGCGCCAAG

AGGGCAG CTCCTGTTTCTCTTCAGCGAAATTCTGTGACTCAATCCAGAGAAGAGTCCAGGCTCAGAGACAACCCGCAGCCTGGGGCACTACCCTCAGAG

AGTGCATCTGGTGGATTCGTGGGAGACAGACAACCAAACTCAGGGCTGAGCTGTGGGAATAGAACAGCTCTGTGCTGTCTCCCTGCCCGCATTGCCCAGA

CACCTGTGAGGTCAGATCCCTCACTGACTCCTCGCTCAGGTCTGTCTAGGACCCTTTCAGATGAGAACAGGCCCAGCCGGACACACAGCAGCAGCCCCCA

ACTCAATGGCTCCAATGTACGGGTTAGTTCTGCCTCGACTAAGATCGTGACTCATTCTAGCTTTCCATCGAAAAATACAGCTTCTGGGCTTCCTCAGAGA

ACAGGTCCCAGGAGACCTGATTTCTCCAAGCTACCCAGGATACCAAAGATCCATCGGGATGGCAATAAGAGCACGCAGGACCAGGCCCCAGCCAGCGGCC

ACATTGTCGAGCTCCCTAGCACTTGCATCAGCCGCCTGACTGGCAGGGAAGGCCCTGGGCAGCCAGGACGAGGCCGAGTCGACAGTGAGCCAAGCAGCAG

GGGTCCCCAGGAGACTGGCTCACACACAAGTGGTTCTCGACCTCCTGCGCCCAGCTCCCATGGCAGCTTAGCCCATCTAGGGCCCTCAAGAGGAAAGGGC

ATTGGGTCTAGCTTTGAAAGTTTCCGGATCAACATCCCTGGGAACACTGCACATTGCAGCCAGCTGTCCAGCCCTGGATTCTGTAACACGTTCCGGCCGG

TAGACAGCAAGGTGCAGAGGAAGGAGACCCCGTTCCCCCTCTTCTCCATCAAGAAGCCGAAACAACTCAAAAGCGAAATCTATGACCCCTTTGACCCCAC

TGGCTCGGACTCTAGCCCTCCTAGCAGCAGCCCAGAGAGTCTTGGTCCAGGCCTCCTACCCTCTGAGATCACAAGAACTATCTCCATCAACAGCCCAAAG

GCCCCAGCCTTCCAGACTGTGCGCTGTGTTACCTCCTACAGGGTAGAAAGCATCTTTGGGACTGAGATGGAACCTGAGCCCCAGCCCCCTAGTGAGCCTG

TATCTGGCATGCTGGAGTTACTCAGCAAGGGATCTGCTGAGGGAACCTCTGATTTGGAGCAAGAGGGACTAGGGGAAATAGAGCCTACAGAGATTCGGGG

CTCCACAGCCCGGACACAGAGGCCACCCCCACCAGACCCTTGGGATGATGAGGACGAAGTGTCCTGTACACCCTTCTTTGGCTCTGAGGAACGGACAGTG

ACGTGTGTGACTGTTGAGGAGCCAGGTGTTCTACCAAGCCCAGATGCTCCACAGATCACCACCCACAGAATTGTGGAGTTCAGGGCCTCATCCCGTTCCC

GCTCCACCTCCAGCTCCCGAAGCAGGAAGAAAACGAAGAAGAAGAAGAAAAAGGTTGCCAGAGAGCACCAGAGGACACGCTCCAGCACTCGCTCTGGCTC

CAGGGACAGGACTTCACGCTCAGTATCTCCAGTTGCTGAGGAACACACCAGGAGGCACAGAGCCAAGACTAAGAGCCGGAGGTCTTCCAGTGACCGTGCC

AGCAGCCAGGACAGAGCAAAGAGGAGGAAGGACAGAGACGACAGAGACAGGGAGCATAGGCGGGGTTCCTGGGGTCATGGCAGGTGCCGGCGGAAGTCCA

GGTCTCGCTCAGGGAGCCCTGGCAGTTCTTCCTGTGAGCGCCATGAGAGTAAGAGACGGAAGAGGCGACATTCGGGGTCCAGGTCTCGGGGCAGCAGTCT

GGAGAGGGACCGGAGACACAAACATCGGGAGAGGAGCCGAGAGCGAATGGACAAGCAGGAGAGTGTGACCCGGTCCCGGGAGAGGAGGAGGTGGCGATCT

CGGTCGCCTAGCTTGGAGCATAGGCCACGAAGGCCACCTTCCCGTGAGAAGCGTGCCCATTCCCCAGAGAAAAAGGGGCCTGTGAGGGAGGTTTCCCCAG

CCCCTGCTACACAGGGGGAGTCGAGGCAGGATGGAGACCACTCTGCTGAGCCTCCGGTTTCAGAAGTAAGTGTCTTGCCTGAGGTAGTAAGTGTCCTGCC

AGAGGTGGTTGTGGCTGACCTGAACCCTCCAGAAGTCCCTCCTGTCCTGGCAGAGCCAGTTGCCCATGTGCCTGAGGACCTGGACTATGGTGAGTCTGTG

GAGGCAGGCCACGTCTTTGAGGATTTTTCAAATGAAGCCATCTTCATCCAGCTCGATGACATGAGCTCGCCTCCTTCTCCTGAGAGTACAGACTCCTCCC

CTGAGAGAGACTTCCCACCAAATCCCATACTGCCCCCAGCCAGCCTTCCACAAGACAGTACTTTACCTACCATCCAAAGGGAGGTGTTACCCATTCACAG

TGAAGATATCTCAAAGCCTGTGCCCCAGGCCTTGGCCCCATCAGACCAGAGTCTGCTCAAGCAAGACACTGTAGAGATCACCACTACAACTCCCAGCACC

CCAGCTGTGGTGCCCATGACAAAGGACAGTCCGGTGCTGAGTGCAAGAGGATGGGAAGCAGTCAGGCCCAGGGATGCTGTGGCCCAGGCCCCACTGCTAC

GATCCCGAACCCTGGTGAAAAGAGTCACCTGGAACCTGCAGGAAGCAGAACACAGCACGCCAGCAGCCCTGGACAGAGATCCAA GGACACCACTTCAGA

GGCCCCAGAGGCCCCAGGAAGGAGACTGGGATGCAGAGGACAGGGCCCTCATAGGATTTCAGCAGGCACCATTCTCCGAGCTGCCCCCTCCCATCCACGT

GCTCCAGGAGTCTGGGTTACCTGATGCAGATCCCTCTCAG CCCCCTGGTGCTCCCAGGGCAGAAGGGCTTCCAGCTGCTGGGACTCTGCACTCAGCAGG

GGGTATTCTTGCCCAGGTTTACAGCCCCAACATGCCACCACCCTTGGCTCAGCCCTCAAGCATCCTGCCCTATGCACTGGTCAGCCAGCCCTCAGTCCAG

TTGATCCTGCAGGGGACCCTTCCCCTAGCAGGCTGCGGTACAGCACAGAGCCTGGCACCAGTGCCCACAATGCCAGCTACAGTCTCAGAGCTAGCTGTTC

CAACCACCAACAACTCAGAAGAAAGGACTGCTACTCCCAAAACAGCTGCTGAGAAGACCAAAAAGGAGGAG TACATGAAGAAGCTGCACATGCAAGAAC

GGGCTGTGGAGGAGGTGAAGCTGGCCATTAAACCCTTCTACCAGAAGAGAGAAGTGACCAAGGAGGAGTACAAGGACATACTGCGCAAAGCCGTGCAGAA

G ATCTGCCACAGCAAGAGTGGTGAAATCAACCCTGTAAAGGTGGCCAACCTGGTGAAGGCCTATGTGGACAAATACAGGCATATGCGCAGACACAAGAA

GACTGAAGGTGGAGAGGAGCCACCCACTCAGGGTGCTGAGACCTGAGGCTAGCCACTCTCTGGGGAGGCATCCCCAGCGGGAAAGAAAT
Translation
MFTDQYFCLQIPVENTKACEAEEEDPTFCEVCGRSDREDRLLLCDGCDAG GYHMECLDPPLQEVPVDEWFCPECTVPGVDPTHD DAAPVSDEEVSLLL

ADVVPTTSRLRPRVGRTRAIARTRQSERVRATVNRNRISSARRVQ HVPRYLMSSLLDETIEAVATGLSTAVYQRPLTPRVPAKRKRKAG GRRKKVLGR

KKTRSRSSVKSKSGSTRAKKRQHRVRKTKGRKLK NEVTARSRIARTLGLRRPVRGTSMPSVYKPVDPSLGLMRADIGAASLSLFGDPYELDPFDS - U

NI28108 - SNEEQSADPPSPLSAKRRVLSRSALQSHQPVARPVAMGLSR RRQLPAVAPEPSVEEAPVPDLLGSILSGQSLLMMSSADVVIHRDGSLS

AKRAA APVSLQRNSVTQSREESRLRDNPQPGALPSESASGGFVGDRQPNSGLSCGNRTALCCLPARIAQTPVRSDPSLTPRSGLSRTLSDENRPSRTHS

SSPQLNGSNVRVSSASTKIVTHSSFPSKNTASGLPQRTGPRRPDFSKLPRIPKIHRDGNKSTQDQAPASGHIVELPSTCISRLTGREGPGQPGRGRVDSE

PSSRGPQETGSHTSGSRPPAPSSHGSLAHLGPSRGKGIGSSFESFRINIPGNTAHCSQLSSPGFCNTFRPVDSKVQRKETPFPLFSIKKPKQLKSEIYDP

FDPTGSDSSPPSSSPESLGPGLLPSEITRTISINSPKAPAFQTVRCVTSYRVESIFGTEMEPEPQPPSEPVSGMLELLSKGSAEGTSDLEQEGLGEIEPT

EIRGSTARTQRPPPPDPWDDEDEVSCTPFFGSEERTVTCVTVEEPGVLPSPDAPQITTHRIVEFRASSRSRSTSSSRSRKKTKKKKKKVAREHQRTRSST

RSGSRDRTSRSVSPVAEEHTRRHRAKTKSRRSSSDRASSQDRAKRRKDRDDRDREHRRGSWGHGRCRRKSRSRSGSPGSSSCERHESKRRKRRHSGSRSR

GSSLERDRRHKHRERSRERMDKQESVTRSRERRRWRSRSPSLEHRPRRPPSREKRAHSPEKKGPVREVSPAPATQGESRQDGDHSAEPPVSEVSVLPEVV

SVLPEVVVADLNPPEVPPVLAEPVAHVPEDLDYGESVEAGHVFEDFSNEAIFIQLDDMSSPPSPESTDSSPERDFPPNPILPPASLPQDSTLPTIQREVL

PIHSEDISKPVPQALAPSDQSLLKQDTVEITTTTPSTPAVVPMTKDSPVLSARGWEAVRPRDAVAQAPLLRSRTLVKRVTWNLQEAEHSTPAALDRDPR 

RTPLQRPQRPQEGDWDAEDRALIGFQQAPFSELPPPIHVLQESGLPDADPSQ PPGAPRAEGLPAAGTLHSAGGILAQVYSPNMPPPLAQPSSILPYALV

SQPSVQLILQGTLPLAGCGTAQSLAPVPTMPATVSELAVPTTNNSEERTATPKTAAEKTKKEE YMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDI

LRKAVQK ICHSKSGEINPVKVANLVKAYVDKYRHMRRHKKTEGGEEPPTQGAET
Transcript ENSMUST00000046688
Sequence
GTCGGGGAGCGCGCGGCGACGGCGGCGGCGGCTGACCGGCCTACTTGCGGTCGTGTTCGGACAGAGGCGGGATCGTCTAGGAGCGTCCGGGAGGCGCGAG

GTTCCCGG - UNI162 - - UNI5382 - - UNI34485 - AGGTGAACTCCAATGTGCAGCCATGGATGACGACAACTTGGATGAGCTTGTGGCG

CACAGCCCTGGGCCAGATGGACCCCCACGGGTTGGCTCCTCAGAACTGGCCAGTGATGCTG - UNI5382 - - UNI10023 - AAGAAAGCAGCAA

TGGCCAAAGTGGAGACTCTGAAGATGATACAGGCAGTGAGCAGGATGATGACACAGATGGGGAGGAAACAGAGGGGCTGTCTGAAGAGGAAGACCCAGAG

GATAGATCTG - UNI10023 - - UNI15512 - - UNI20794 - GTTCTGAAGACTCAGAAGATGGAGTAGAAATGGCAACGGCAGCAATAGAG

ACTCAAGGGAAGCTTGAAGCTAGCAGTGTACCCAATTCTGATGATGATGCAGAGAGCTGCCCCATTTGCCTCAATGCATTTAGAGACCAGGCTGTGGGCA

CCCCAGAGACCTGTGCCCATTATTTCTGCCTGGATTGCATCATCGAATGGTCCAGG - UNI20794 - AATGCCAACTCCTGTCCTGTTGATCGAACA

GTATTTAAATGTATTTGTATTCGTGCCCAGTTTAATGGTAAAATCTTAAAGAAG ATTCCAGTAGAAAACACTAAAGCTTGTGAGGCTGAGGAGGAAGAC

CCGACTTTTTGTGAGGTGTGTGGCAGGAGTGATCGTGAGGACCGGCTCCTACTGTGTGACGGCTGCGATGCTGG ATGCAGCTCCTGTGAGTGATGAGGA

GGTCTCCTTGCTACTGGCTGATGTAGTACCTACTACAAGCAGGCTTCGGCCTCGAGTAGGCAGGACCCGGGCCATCGCTAGGACACGGCAGAGTGAGAGA

GTGAGGGCAACTGTGAACCGGAACCGGATCTCCTCTGCCAGAAGGGTCCAG CATGTGCCAAGGTACCTCATGTCTTCTCTGCTGGATGAAACTATTGAG

GCTGTCGCCACTGGGCTGAGCACTGCTGTATACCAGCGTCCCTTGACACCTCGTGTCCCTGCAAAACGGAAAAGGAAGGCAG GGAGACGAAAGAAAGTG

CTGGGAAGAAAGAAAACTCGGTCCAGGTCATCTGTGAAAAGTAAGAGTGGGAGTACGAGAGCCAAGAAACGTCAGCACCGTGTAAGGAAGACAAAAGGGA

GGAAGCTGAAG AATGAAGTCACAGCTCGTTCTCGAATTGCACGAACACTAGGCCTCCGCAGGCCTGTCCGTGGCACCAGCATGCCATCAGTGTACAAGC

CAGTGGACCCCTCCCTCGGGCTGATGAGGGCAGACATTGGAGCAGCTTCCCTGTCACTGTTTGGAGATCCCTATGAGCTGGATCCTTTTGACAG - UNI

28108 - CAATGAAGAACAGTCTGCAGATCCACCTTCCCCTCTGAGTGCCAAGAGGAGAGTGCTGTCCCGCTCAGCTCTGCAGTCTCACCAGCCTGTGG

CCAGACCTGTCGCCATGGGGCTCTCTAG GAGGCAGCTCCCTGCTGTGGCCCCAGAGCCCAGCGTGGAGGAGGCCCCCGTTCCTGACCTGTTGGGAAGCA

TCCTGTCTGGCCAGAGCCTCCTGATGATGAGCAGTGCTGATGTTGTCATACACCGGGATGGCTCTCTCAGCGCCAAGAGGGCAG CTCCTGTTTCTCTTC

AGCGAAATTCTGTGACTCAATCCAGAGAAGAGTCCAGGCTCAGAGACAACCCGCAGCCTGGGGCACTACCCTCAGAGAGTGCATCTGGTGGATTCGTGGG

AGACAGACAACCAAACTCAGGGCTGAGCTGTGGGAATAGAACAGCTCTGTGCTGTCTCCCTGCCCGCATTGCCCAGACACCTGTGAGGTCAGATCCCTCA

CTGACTCCTCGCTCAGGTCTGTCTAGGACCCTTTCAGATGAGAACAGGCCCAGCCGGACACACAGCAGCAGCCCCCAACTCAATGGCTCCAATGTACGGG

TTAGTTCTGCCTCGACTAAGATCGTGACTCATTCTAGCTTTCCATCGAAAAATACAGCTTCTGGGCTTCCTCAGAGAACAGGTCCCAGGAGACCTGATTT

CTCCAAGCTACCCAGGATACCAAAGATCCATCGGGATGGCAATAAGAGCACGCAGGACCAGGCCCCAGCCAGCGGCCACATTGTCGAGCTCCCTAGCACT

TGCATCAGCCGCCTGACTGGCAGGGAAGGCCCTGGGCAGCCAGGACGAGGCCGAGTCGACAGTGAGCCAAGCAGCAGGGGTCCCCAGGAGACTGGCTCAC

ACACAAGTGGTTCTCGACCTCCTGCGCCCAGCTCCCATGGCAGCTTAGCCCATCTAGGGCCCTCAAGAGGAAAGGGCATTGGGTCTAGCTTTGAAAGTTT

CCGGATCAACATCCCTGGGAACACTGCACATTGCAGCCAGCTGTCCAGCCCTGGATTCTGTAACACGTTCCGGCCGGTAGACAGCAAGGTGCAGAGGAAG

GAGACCCCGTTCCCCCTCTTCTCCATCAAGAAGCCGAAACAACTCAAAAGCGAAATCTATGACCCCTTTGACCCCACTGGCTCGGACTCTAGCCCTCCTA

GCAGCAGCCCAGAGAGTCTTGGTCCAGGCCTCCTACCCTCTGAGATCACAAGAACTATCTCCATCAACAGCCCAAAGGCCCCAGCCTTCCAGACTGTGCG

CTGTGTTACCTCCTACAGGGTAGAAAGCATCTTTGGGACTGAGATGGAACCTGAGCCCCAGCCCCCTAGTGAGCCTGTATCTGGCATGCTGGAGTTACTC

AGCAAGGGATCTGCTGAGGGAACCTCTGATTTGGAGCAAGAGGGACTAGGGGAAATAGAGCCTACAGAGATTCGGGGCTCCACAGCCCGGACACAGAGGC

CACCCCCACCAGACCCTTGGGATGATGAGGACGAAGTGTCCTGTACACCCTTCTTTGGCTCTGAGGAACGGACAGTGACGTGTGTGACTGTTGAGGAGCC

AGGTGTTCTACCAAGCCCAGATGCTCCACAGATCACCACCCACAGAATTGTGGAGTTCAGGGCCTCATCCCGTTCCCGCTCCACCTCCAGCTCCCGAAGC

AGGAAGAAAACGAAGAAGAAGAAGAAAAAGGTTGCCAGAGAGCACCAGAGGACACGCTCCAGCACTCGCTCTGGCTCCAGGGACAGGACTTCACGCTCAG

TATCTCCAGTTGCTGAGGAACACACCAGGAGGCACAGAGCCAAGACTAAGAGCCGGAGGTCTTCCAGTGACCGTGCCAGCAGCCAGGACAGAGCAAAGAG

GAGGAAGGACAGAGACGACAGAGACAGGGAGCATAGGCGGGGTTCCTGGGGTCATGGCAGGTGCCGGCGGAAGTCCAGGTCTCGCTCAGGGAGCCCTGGC

AGTTCTTCCTGTGAGCGCCATGAGAGTAAGAGACGGAAGAGGCGACATTCGGGGTCCAGGTCTCGGGGCAGCAGTCTGGAGAGGGACCGGAGACACAAAC

ATCGGGAGAGGAGCCGAGAGCGAATGGACAAGCAGGAGAGTGTGACCCGGTCCCGGGAGAGGAGGAGGTGGCGATCTCGGTCGCCTAGCTTGGAGCATAG

GCCACGAAGGCCACCTTCCCGTGAGAAGCGTGCCCATTCCCCAGAGAAAAAGGGGCCTGTGAGGGAGGTTTCCCCAGCCCCTGCTACACAGGGGGAGTCG

AGGCAGGATGGAGACCACTCTGCTGAGCCTCCGGTTTCAGAAGTAAGTGTCTTGCCTGAGGTAGTAAGTGTCCTGCCAGAGGTGGTTGTGGCTGACCTGA

ACCCTCCAGAAGTCCCTCCTGTCCTGGCAGAGCCAGTTGCCCATGTGCCTGAGGACCTGGACTATGGTGAGTCTGTGGAGGCAGGCCACGTCTTTGAGGA

TTTTTCAAATGAAGCCATCTTCATCCAGCTCGATGACATGAGCTCGCCTCCTTCTCCTGAGAGTACAGACTCCTCCCCTGAGAGAGACTTCCCACCAAAT

CCCATACTGCCCCCAGCCAGCCTTCCACAAGACAGTACTTTACCTACCATCCAAAGGGAGGTGTTACCCATTCACAGTGAAGATATCTCAAAGCCTGTGC

CCCAGGCCTTGGCCCCATCAGACCAGAGTCTGCTCAAGCAAGACACTGTAGAGATCACCACTACAACTCCCAGCACCCCAGCTGTGGTGCCCATGACAAA

GGACAGTCCGGTGCTGAGTGCAAGAGGATGGGAAGCAGTCAGGCCCAGGGATGCTGTGGCCCAGGCCCCACTGCTACGATCCCGAACCCTGGTGAAAAGA

GTCACCTGGAACCTGCAGGAAGCAGAACACAGCACGCCAGCAGCCCTGGACAGAGATCCAA GGACACCACTTCAGAGGCCCCAGAGGCCCCAGGAAGGA

GACTGGGATGCAGAGGACAGGGCCCTCATAGGATTTCAGCAGGCACCATTCTCCGAGCTGCCCCCTCCCATCCACGTGCTCCAGGAGTCTGGGTTACCTG

ATGCAGATCCCTCTCAG CCCCCTGGTGCTCCCAGGGCAGAAGGGCTTCCAGCTGCTGGGACTCTGCACTCAGCAGGGGGTATTCTTGCCCAGGTTTACA

GCCCCAACATGCCACCACCCTTGGCTCAGCCCTCAAGCATCCTGCCCTATGCACTGGTCAGCCAGCCCTCAGTCCAGTTGATCCTGCAGGGGACCCTTCC

CCTAGCAGGCTGCGGTACAGCACAGAGCCTGGCACCAGTGCCCACAATGCCAGCTACAGTCTCAGAGCTAGCTGTTCCAACCACCAACAACTCAGAAGAA

AGGACTGCTACTCCCAAAACAGCTGCTGAGAAGACCAAAAAGGAGGAG TACATGAAGAAGCTGCACATGCAAGAACGGGCTGTGGAGGAGGTGAAGCTG

GCCATTAAACCCTTCTACCAGAAGAGAGAAGTGACCAAGGAGGAGTACAAGGACATACTGCGCAAAGCCGTGCAGAAG ATCTGCCACAGCAAGAGTGGT

GAAATCAACCCTGTAAAGGTGGCCAACCTGGTGAAGGCCTATGTGGACAAATACAGGCATATGCGCAGACACAAGAAGACTGAAGGTGGAGAGGAGCCAC

CCACTCAGGGTGCTGAGACCTGAGGCTAGCCACTCTCTGGGGAGGCATCCCCAGCGGGAAAGAAATGGGGCCGCCAGCACTCCTGCCTCTGAGGGTCTCA

TGGTACCTGTCTGCACCTGTCTTGCTTATAATTGAAAACTGGACTTTTTTATATGTATATTATAGATACACTGTTTCCATTGTGTTCTAATTTATCAAAA

ATGGCTTATGTTTAGAAACTTT
Translation
 - UNI162 - - UNI5382 - - UNI34485 -  - UNI5382 - - UNI10023 -  - UNI10023 - - UNI15512 - - UNI20794

 -  - UNI20794 -  MLD DAAPVSDEEVSLLLADVVPTTSRLRPRVGRTRAIARTRQSERVRATVNRNRISSARRVQ HVPRYLMSSLLDETIEAV

ATGLSTAVYQRPLTPRVPAKRKRKAG GRRKKVLGRKKTRSRSSVKSKSGSTRAKKRQHRVRKTKGRKLK NEVTARSRIARTLGLRRPVRGTSMPSVYK

PVDPSLGLMRADIGAASLSLFGDPYELDPFDS - UNI28108 - SNEEQSADPPSPLSAKRRVLSRSALQSHQPVARPVAMGLSR RRQLPAVAPEPS

VEEAPVPDLLGSILSGQSLLMMSSADVVIHRDGSLSAKRAA APVSLQRNSVTQSREESRLRDNPQPGALPSESASGGFVGDRQPNSGLSCGNRTALCCL

PARIAQTPVRSDPSLTPRSGLSRTLSDENRPSRTHSSSPQLNGSNVRVSSASTKIVTHSSFPSKNTASGLPQRTGPRRPDFSKLPRIPKIHRDGNKSTQD

QAPASGHIVELPSTCISRLTGREGPGQPGRGRVDSEPSSRGPQETGSHTSGSRPPAPSSHGSLAHLGPSRGKGIGSSFESFRINIPGNTAHCSQLSSPGF

CNTFRPVDSKVQRKETPFPLFSIKKPKQLKSEIYDPFDPTGSDSSPPSSSPESLGPGLLPSEITRTISINSPKAPAFQTVRCVTSYRVESIFGTEMEPEP

QPPSEPVSGMLELLSKGSAEGTSDLEQEGLGEIEPTEIRGSTARTQRPPPPDPWDDEDEVSCTPFFGSEERTVTCVTVEEPGVLPSPDAPQITTHRIVEF

RASSRSRSTSSSRSRKKTKKKKKKVAREHQRTRSSTRSGSRDRTSRSVSPVAEEHTRRHRAKTKSRRSSSDRASSQDRAKRRKDRDDRDREHRRGSWGHG

RCRRKSRSRSGSPGSSSCERHESKRRKRRHSGSRSRGSSLERDRRHKHRERSRERMDKQESVTRSRERRRWRSRSPSLEHRPRRPPSREKRAHSPEKKGP

VREVSPAPATQGESRQDGDHSAEPPVSEVSVLPEVVSVLPEVVVADLNPPEVPPVLAEPVAHVPEDLDYGESVEAGHVFEDFSNEAIFIQLDDMSSPPSP

ESTDSSPERDFPPNPILPPASLPQDSTLPTIQREVLPIHSEDISKPVPQALAPSDQSLLKQDTVEITTTTPSTPAVVPMTKDSPVLSARGWEAVRPRDAV

AQAPLLRSRTLVKRVTWNLQEAEHSTPAALDRDPR RTPLQRPQRPQEGDWDAEDRALIGFQQAPFSELPPPIHVLQESGLPDADPSQ PPGAPRAEGLP

AAGTLHSAGGILAQVYSPNMPPPLAQPSSILPYALVSQPSVQLILQGTLPLAGCGTAQSLAPVPTMPATVSELAVPTTNNSEERTATPKTAAEKTKKEE 

YMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQK ICHSKSGEINPVKVANLVKAYVDKYRHMRRHKKTEGGEEPPTQGAET

For any suggestions or comments, please send an email to unitrap@crg.es