Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038658 (C030046E11Rik)
Chromosomal location
Chr 19: 29596772 - 29680411 (+)
Description
RIKEN cDNA C030046E11 gene Gene [Source:MGI Symbol;Acc:MGI:1924893]
RefSeq_dna
NM_001081319 
RefSeq_peptide
NP_001074788.1 
UniGene
Mm.353838 
MGI
MGI:1924893 
Uniprot/SWISSPROT
Q69ZJ7 
Uniprot/SPTREMBL
Q05A17 
Human Ortholog
ENSG00000107036 (KIAA1432)
Omim not available
UniTrap UNI18930
Vector Insertion
Chr 19: 29597157 - 29607654
Public Clones not available
Private Clones OST410726 (lexicon) OST341487 (lexicon) OST50876 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22849
Vector Insertion
Chr 19: 29615424 - 29615745
Public Clones not available
Private Clones OST283089 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32879
Vector Insertion
Chr 19: 29615826 - 29636474
Public Clones IST11272A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17943
Vector Insertion
Chr 19: 29662337 - 29669288
Public Clones not available
Private Clones OST432979 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4353
Vector Insertion
Chr 19: 29670490 - 29672236
Public Clones AF0338 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063343
Sequence
ATGATAGTTTTAGGG - UNI22849 - ACAGCAAATGGCTACATCTTGTTTTTTCATATTACATCTTCAAGAGGGGATAAATACCTTTATGAACCAGT

GTATCCCAA - UNI32879 - AGGAAGTCCACAAATGAAGGGGATACCTCATTTTAAGGAAGAACATTGTGCCCCAGCATTGAATTTAGAAATGAAGA

AAATACTGGATTTGCAAGCACCCATTATGAGGTATGGTATGCTGGTTAAGTTTGAGATTTTCTGACCACAAAAGACCATGTAGTTGATTAAATCATATGA

CAAACAAGAAAATTGTTTGCATTTCAAAATGTATAAATTAACTGTTTGATTGTATGGAATGATAACATACTAAAAGATTCAAATAAAATCATGTATGAGA

AGAAAAGAGGGAGCTGTCGCTCTCTGCAGCCTCCATGTGTTTCTTGGAAGTACGAGTACACTTGAAGGAGTGTTAAGCTTTCTGATTGCAGTGTGAGTAG

ATGTCGTGTGACAAGGCAGTAAGAACTACTAAAGCACAGAACTCTATTCTCAATGTTTTTTTTTTTTTTCAGTTTCACTTTACTATCTTAAGTGCTTCAT

GGCTGGCCTTTTATTTATTACCGTCCTTCCCTCTGCATACATGATTTTTGTGAACAGTACACAGCTGTGAAAACAAATGAGGCTCAATCTTTAAGAGACT

TTCCAGATACACTGTTGGTTAAAGAGCAAGGTGTATACAGTGGTAAGAATGCTTGGTCTTAAATGGTATTAGAAGTTTGTTGTCTAGAAGAGTACATAAG

TTAGTGGGACAGGTTTAGGGAAAAGTTTTTTTATTAGGTACCTTTCAGACGTATTAAGCCATGGACCAGGAAGATGTAGGTAAAAGTGCTTGCTTCCAAA

CCTAATGAGTTACTTCCCCAGTGCCCACGTGGTAGGAATGAAGAATTGATTCCCAAGGTTGGCCTCTGCCCTTCAAACATGCACCGTGGCATGTCCAAGC

ACCCACACCCCAGATAAATAAATAAAAGTGTAACAATTTTAAAAACAAAAAGACTGAGCATATTACTGTAGTATGGAGCTATTGGACTATATAAAAATGT

AATTCCAACATTTTAAAAGACCTCTCTGATTTATAGTTCAAACGAAGGGCATCTTTCACCATTTTGTTGTTGTTGTTAAACCACCACTCACTAGAACAAA

CAGCAGAGTTGACATTTGAGCCGTGAGCTGTTGTCATTCCCTTGTGTAGTCTGTGCTCTTATCCTTTAGTCTCCGAGTGGAGAAGAAAGTCTTTGTTACT

TGCTTAAATGAGATTAAACTGAAACATTTTAGTTTAGTATGTTCACTGTGTTGATCAAAGGTTACTGATCACTTCAGATTTTATTTGCTCATGATAAAAG

CCCTTTTTAAAGAATGCAACTTGAAGTAGCTCAGTGTGTAAGAGTGTTTGCCTCATACGCATGATACCCAAGTACAAATACTCTACCCCACATAAAAATA

TGTGTGGAATCACAGCCAAGCCTGTAACTCTAGTGCTGACGTGGGCAGAAGGATTGCTAGGGACTGCTGGCTGCCAGCCTAGCTCCAGTTCTGTGGAAGA

CCCTTTCTCAGGGGAGTGAGGTACAGTGTGATAGAGCAGTATACTCCTTGGCCGCCATATGTGTGAACATAGATGTGCATACACCACACACACGCACACG

CACACGCACACAAACACACACACACACACACACACTATTAAAGTTAGAAGACTTGATGC
Translation
MIVLG - UNI22849 - TANGYILFFHITSSRGDKYLYEPVYPK - UNI32879 - KGSPQMKGIPHFKEEHCAPALNLEMKKILDLQAPIMRYGM

LVKFEIF
Transcript ENSMUST00000043610
Sequence
GCCGCGGGCCCACTGGCCGCCCGCCTCCCCCACCCTCGGCCGGTCAGCGTCCCAGACTGCGTCGCGCAGCATCGCGTCGGCCCGGCCCGGCCCGGCCCCC

GGGCAGATGCCCCGAGTTGCCGCTGTCGCCGCCGCCGACTCGGCCGGTGGCGGTGTGGGAGGTGGGCGCCTGGCCCGGGGCCGCCGAGCGTGACAGACAC

GGCCGGGGCCGCCGGGGGGCTGTCGGGGCCGCGCGCGGACCATGTATTTCCTGAGCGGCTGGCCCAAGAGGCTGCTCTGCGCGCCGCGGAGCCCGGCCGA

GGCGCCGCTCCACGTCCAGTCTGACCCTCGGAGAGCGTTCTTCGCCGTGCTGGCCCCGGCCCGCCTCAGCATCTGGTACAGCCGA - UNI18930 - C

CTAGTGTGTTAATTGTAACATACAAGGAACCAGCTAAATCATCTACTCAGTTTGGATCTTACAAACAAGCTGAATGGAGACCGGATAGTACCATGATAGC

AGTGTCA - UNI22849 - ACAGCAAATGGCTACATCTTGTTTTTTCATATTACATCTTCAAGAGGGGATAAATACCTTTATGAACCAGTGTATCCCA

A - UNI32879 - AGGAAGTCCACAAATGAAGGGGATACCTCATTTTAAGGAAGAACATTGTGCCCCAGCATTGAATTTAGAAATGAAGAAAATACTG

GATTTGCAAGCACCCATTATGAG TTTGCAGTCTGTGCTGGAAGATCTCCTTGTTGCAACTTCTGATGGACTTCTTCATCTTATTCATTGGGAAGGAATG

ACAAATGGAAGAAAAGCCATCAATCTGTCTACAGTACCATTTTCAGTAGACCTCCAGTCATCCAGAG TTGGTTCATTCCTCGGCTTTGCAGATGTGCAC

ATTAAAGATATGGAATACTGTGCCACACTTGATGGATTTGCTGTTGTGTTTAATGATGGTAAAGTTGGATTTATTACACCAGTATCCAGTAGATTTACGG

CAGAG CAACTTCATGGAGTTTGGCCACAAGATGTTATTGATGGGACTTGTGTTGCAGTAAACAACAAATACCGACTGATGGCCTTTGGCTGTGCAAG T

GGCTGTGTGCAGGTTTATACAATCGACAACACTACAGGAGCCATGCTGCTGTCCCATAAACTAGAGCTCACAGCAAAGCAGTATCCTG ACATCTGGAAC

AAAACAGGAGCTGTTAAATTGATTAGATGGTCTCCTGACAACAGCGCTGTAATAGTAACCTGGGAATATGGAGGTCTTTCTCTGTGGAGTGTGTTTGGAG

CCCAGCTGATATGTACACTTGGAGGAGACTTCGC TTACAGGTCAGATGGTACCAAAAAAGATCCCCTTAAGATCAACTCCATG AGCTGGGGTGCAGAA

GGCTATCACTTATGGGTAATCAGTGGGCTGGGCTCTCAGCACACTCAGATTGAGACCGACCTCAGGAGCACAGTTAAAGAGCCCAGCATTCTGCTGTTTC

AGTTTATCAAGAGTGTACTCACTGTGAACCCTTGTATG AGTAACCAAGAGCAGGTGTTGCTTCAGGGAGAAGATCGCTTGTACTTGAACTGTGGAGAAG

CCTCACAGGCCCAGAATCCGAAGTACTCTTCAGCACGTGCTGAGCGTATGCCCAGGCATGAGAAGAGCCCATTTGCAGATGGAGGTCTGGAGGCTCCGGG

ATTAAGCACTTTACTTGGTCATCGGCATTGGCATGTTGTGCAG ATTTCCAGCACCTATCTAGAAAGCAATTGGCCTATACGG TTTTCAGCTATTGATA

AACTTGGACAAAATATTGCTGTGGCTGGCAAGTTTGGATTTGCTCATTATTCTCTACTCACCAAAAAATGGAAACTTTTTGGAAACATTACTCAG GAGC

AAAATATGATTGTGACTGGTGGCTTAGCCTGGTGGGATGACTTTATGGTCCTTGCGTGTTACAACTTAAGTGACCGTCAAGAAGAG CTCAGAATCTACC

TACGAACATCCAACCTGGACAATGCCTTTGCTCATGTCACCAAAGCACCAATGGAAACATTACTGCTTAGTGTCTTCCGCGACATGGTGGTAGTGTTTCG

AGCAGACTGTTCAATATGCCTTTACAGTATTGAAAGAAAATCCGATGG TTCCAATACTACAGCTAGTGTCCAGGTTCTTCAGGAGGTCTCCATGTCACG

GTACATTCCTCACCCCTTCCTGGTAGTGTCTGTCACGCTGACGTCAGTGAGTACAGAGAATGGCATCAGCTTGAAAATGCCGCAGCAG - UNI17943 

- GCTCGTGATGCAGAGAGCATAATGCTGAACCTTGCGGGACAGCTCATCATGATGCAGAGGGACAGGTCAGGCCCGCAGATCCGGGAGAAGGACAGCCA

CCCTAACCAAAGGAAGCTT CTGCCGTTCTGTCCTCCTGTTGTACTAGCCCAGTCGGTGGAAAATGTCTGGACTACCTGTCGAGCAAACAAACAAAAGCG

TCACCTTCTGGAGGCCCTCTGGCTGAGCTGTGGTGGTGCGGGGATGAAGGTTTGGCTCCCTCTCTTCCCCAGGGATCATCGCAAGCCCCACTCCTTCCTG

TCCCAGCGGATCATGCTGCCGTTTCATATCAACATTTACCCCCTGGCCGTTCTGTTTGAAGACGCGTTGGTCCTTGGTGCTGTCAACGACACTCTCCTCT

ATGATTCTCTGTATACCCGGAGCAGTGCCAGGGAGCAGCTGGAGGTGCTCTTTCCCTTCTGTGTTGTGGAGAGGACCTCTCAGATCTACCTCCACCATAT

CCTCCGCCAGCTCCTGGTCAGGAACCTGGGCGAGCAGGCGCTCCTCCTGGCTCAGTCCTGCGCTGCGTTACCTTACTTCCCTCACGTGTTGGAGCTGATG

CTCCACGAGGTGCTGGAGGAAGAAGCTACCTCCCGGGAGCCCATTCCCGACCCGCTGCTGCCCACCGTGGCCAAGTTCATCACCGAGTTCCCCCTCTTCC

TTCAGACAGTCGTGCACTGTGCCAGGAAGACTGAGTATGCTCTGTGGAATTACCTTTTTGCAGCTGTCGGAAACCCCAAGGATTTATTTGAGGAATGTTT

GATGGCTCAGGATTTGGACACAGCTGCCTCTTACCTTATTATCTTACAG - UNI4353 - AATATGGAAGTCCCAGCAGTAAGTAGGCAGCATGCTAC

CCTGCTGTTCAACACAGCACTGGAACAGGGCAAATGGGACCTGTGCCGACACATGATTCGATTTCTTAAAGCCATTGGTTCTGGAGAATCTGAGACCCCT

CCATCCACACCTACATCTCAG GAGCCCAGTTCAAGTGGTGGGTTTGAGTTCTTCAGGAATCGGAGCATCAGTTTATCCCAGTCAGCTGAGAATGTTCCT

CCTGGTAAATTCGGCTTACAGAAAACACTAAGTATGCCAACTGGTCCTTCTGGGAAAAG ATGGAGCAAAGACAGTGAATGTGCTGAGAACATGTATATT

GACATGATGCTGTGGAGACATGCGCGGCGCCTCCTAGAAGAGGTGCGCTTAAAGGACCTTGGCTGCTTTGCAGCCCAGCTAGGCTTTGAACTGATCAGTT

GGCTTTGCAAAGAACGTACCCGAGCTGCCCGTGTAGACAACTTTGTAGTAGCCCTGAAGAGACTTCACAAGGATTTCCTGTGGCCACTTCCCATTATCCC

AGCCTCTTCCATAAGTTCCCCTTTCAAAAATGGGAAATGCCGAGCAG TGGGAGAGCAGATGTTAAAGTCTCAGTCAGCTGACCCTTTTATTACCCCTGA

GATGGACGCTGGCATCTCTAACATCCAACGAAGTCAGAGCTGGCTCAGCAACATTGGTCCCACCCATCGTGACACAGACAGAGCCTCATCTCCTGGACCA

CAAATGCAAGATGCTTTCTTGTCTCCATTATCTAATAAAG GGGATGAGTGCAGCATTGGCTCAGCTACAGACCTGACTGAAAGCAGCTCCGTGGTGGAT

GGAGACTGGACAATGGTGGATGAAAACTTCTCCACCCTCAGCTTGACCCAGTCTGAGCTAGAGCACATCTCCATGGAGTTGGCGAGTAAAGGACCCCATA

AATCTCAGGTCCAGCTTCG CTATTTGCTGCACATTTTCATGGAGGCGGGATGTCTGGACTGGTGTGTTGTCATCGGCCTGATTCTCAGAGAATCCTCAG

TGGTCAGTCAGCTTCTTGGGATTGCTCAGTCTTCCGAGATGGATGGAGAGATGTTACAGAACATAAAATCAGGGCTGCAAGCAGTGGACCGCTGGGCCTC

TACAGACTG CCCTGGATATAAGCCATTTTTAAACATCATTAAGCCACAACTGCAGAAGCTCAGTGAGATAACAGAAGAACTGGTCCAGCCTGACACCTT

CCAGCCAGTAACAGTGGGTAAGACTCCTGAACAGACCAGTCCCCGGGCAGAGGAGAACAGAGGCTCTTGCAGCCATGGGAGCATCTCTCAGAGTGAGCCT

GGGAGTAACAACGTGGTCAGCCGGAAAGAAGAGGACACAACACAGGCGGATGAGGAGGAGCCACTTCAGGATGGGGCTTATGACTGTTCTGTGTCCTGAC

AGCAGTGAGCACGGCACAGCGGGCAGTATTAGTCACAGCAGCTTGCAACTGAGTCATTGTGGCCTGCCGAATGACTTAACAGGTAAAAGAACTTGGGTCA

GAACTCTTTCGTAAAGTATTATAATTTAATGAACTCTTCCTCTAAATCTCTTTGACTCCTTAAAAAAAAGTGTGGTATCAAAGCATCTTTCATAAGAAAA

ATTTAAGCTGCAATAGAAAGTAGTGAACAGTATATAGATGCACACATGGAATATTTTGATTTTATTTACAACAGATTGGTAGTTGTAGGGATTATTCTTA

ACAGGAGGGATTATTTTGCCCCAAGCGAGCTTACTTTTTCACTACTTACAGCTTATATATTTTCTGGTTTAGTGTGTGTCTAGACTGGTTTTGTTTTTGT

GGGGTGGGTTGTTTGTTTTTAACTTTCTTTTAAATATGTGTTAAGGTGCTGTAGCTCATCAGGTAACTGAGCTACTTGTTTGCTTCCTTGTATAGAGTCA

GCGGGACTCTGATTGGTCCTTTGAATCCTACTCTTGCACAGTGTGGGTCAGTGGACAGAGACCCTTTGGCTTTGGTACTCTGTTGACTAGCAGTCCTGAA

TGACGGAAGCTATTTACCTGTGAGTTAATGTGCCTGTTTTAGCAAGCTTAATTTCCTACTAGATCAATGTGGGCAGAGGGTGAGGGGGTTCTTATCAATT

ATGCTGACACCACTAAATTTTGTATCAAAGAACTGTATCTTTTTGTGAATATTCATGTAAATATACTCAAAGGCACTGTCCATATTTTTAATGCGTGTAT

TATAATGTGTAAGGTTTTACGCTGGATTCTGCATGACTATACTCACTCTTGGAATAAAGACAAGACTTTTTCTTCTTTCCAAAATGAGCAGTTGTCATAG

AGGAAGACAGGTTTGTTGGCCCAGCTGTAAAGTAGTGGTCATCCCACTGATCATGAGGCGGAACAGGTTTTGTGCAAATTAATGTAGTTTCTTATTTATT

GCTTTTGTAAATTGAATAAAAACGGGCTTTTATGTAAATAGACTGTGGGATCCTGTATTATCAGCTACTAAAAATTAGTTTGTAAATTCTTTATTATAAA

GTTTAAAAATATTTTATGTATTTCTAGATGTGACTTAAATTTTAGTTTTTCATACATTATGAAAGCAGAACTACATATTCAGTTGCTTCAGACTAAACAC

ATACCTATCACATGTAATTCTAATTATTAATAACAGTATTACTTTAGATAGCTTATTTGTACTGTGCAATTTGAACAAGGAATGCAATGTTATTTTTTAT

AAAATCTTGTTTATTTTTATAACAACAATGTATTTGATGTGGACCAAATTCGTACCACCATGTAAAACAGCCTCTCTTCTAATGCAGATATAGCTTAGAA

GTGGAGTTCAGCCCTCTATCCCTGCCTTTTAAACTAGAGAGATAGACGAGGTCCTCTTAGGCAGTATCTTTTAGAGGAAACCTCAGCATTATTTTGAAAT

TATTTCAAATTTCACCAACTAGTTAAAATTATTGAATTTAGTAATTACTGTTATTTACTTTCTACATTAGAAGTGCAATAATTTTACATAATAAAATTAC

TGGATGGGTGAAATATGTTATTGGTACCTGGTCCTTCTGGTGCTATTTTTATTTAAGTTGTATCAAACCACCACCTTGTTCTGAATTTTAAAATAGAGAA

TAAGGTTTCCTATATACGTAGATGCAGTGTTGCAAAATAAATGAATAAATAAATAAAGCAAGCTGAAATTT
Translation
MYFLSGWPKRLLCAPRSPAEAPLHVQSDPRRAFFAVLAPARLSIWYSR - UNI18930 - PSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVS -

 UNI22849 - TANGYILFFHITSSRGDKYLYEPVYPK - UNI32879 - KGSPQMKGIPHFKEEHCAPALNLEMKKILDLQAPIMS SLQSVLEDL

LVATSDGLLHLIHWEGMTNGRKAINLSTVPFSVDLQSSRV VGSFLGFADVHIKDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAE QLHGVWPQDVID

GTCVAVNNKYRLMAFGCAS SGCVQVYTIDNTTGAMLLSHKLELTAKQYPD DIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSVFGAQLICTLGGDF

A AYRSDGTKKDPLKINSM SWGAEGYHLWVISGLGSQHTQIETDLRSTVKEPSILLFQFIKSVLTVNPCM SNQEQVLLQGEDRLYLNCGEASQAQNPK

YSSARAERMPRHEKSPFADGGLEAPGLSTLLGHRHWHVVQ ISSTYLESNWPIR FSAIDKLGQNIAVAGKFGFAHYSLLTKKWKLFGNITQ EQNMIVT

GGLAWWDDFMVLACYNLSDRQEE LRIYLRTSNLDNAFAHVTKAPMETLLLSVFRDMVVVFRADCSICLYSIERKSDG GSNTTASVQVLQEVSMSRYIP

HPFLVVSVTLTSVSTENGISLKMPQQ - UNI17943 - ARDAESIMLNLAGQLIMMQRDRSGPQIREKDSHPNQRKL LPFCPPVVLAQSVENVWTTC

RANKQKRHLLEALWLSCGGAGMKVWLPLFPRDHRKPHSFLSQRIMLPFHINIYPLAVLFEDALVLGAVNDTLLYDSLYTRSSAREQLEVLFPFCVVERTS

QIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPK

DLFEECLMAQDLDTAASYLIILQ - UNI4353 - NMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTSQ EPSSSGGFEF

FRNRSISLSQSAENVPPGKFGLQKTLSMPTGPSGKR RWSKDSECAENMYIDMMLWRHARRLLEEVRLKDLGCFAAQLGFELISWLCKERTRAARVDNFV

VALKRLHKDFLWPLPIIPASSISSPFKNGKCRAV VGEQMLKSQSADPFITPEMDAGISNIQRSQSWLSNIGPTHRDTDRASSPGPQMQDAFLSPLSNKG

 GDECSIGSATDLTESSSVVDGDWTMVDENFSTLSLTQSELEHISMELASKGPHKSQVQLR RYLLHIFMEAGCLDWCVVIGLILRESSVVSQLLGIAQS

SEMDGEMLQNIKSGLQAVDRWASTDC CPGYKPFLNIIKPQLQKLSEITEELVQPDTFQPVTVGKTPEQTSPRAEENRGSCSHGSISQSEPGSNNVVSRK

EEDTTQADEEEPLQDGAYDCSVS

For any suggestions or comments, please send an email to unitrap@crg.es