Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038705 (Gmeb2)
Chromosomal location
Chr 2: 180986156 - 181022671 (-)
Description
glucocorticoid modulatory element binding protein 2 Gene [Source:MGI (curated);Acc:Gmeb2-001]
RefSeq_dna
NM_198169 
RefSeq_peptide
NP_937812.1 
UniGene
Mm.470334 
MGI
MGI:2652836 
Uniprot/SWISSPROT
P58929 
Uniprot/SPTREMBL
A2AS06 A2AS07 Q6ZPV0 
Human Ortholog
ENSG00000101216 (GMEB2)
Omim not available
UniTrap UNI21290
Vector Insertion
Chr 2: 181012827 - 181022588
Public Clones (sanger) D105H11 (ggtc) E112H11 (ggtc) D087H02 (ggtc) D123G10 (ggtc)
D053B11 (ggtc) CMHD-GT_518C6-3 (cmhd) CMHD-GT_525H1-3 (cmhd) IST10916B8 (tigm)
IST10039B1 (tigm) IST10895H7 (tigm) IST14787F5 (tigm) IST12740C9 (tigm)
IST14564G10 (tigm) IST14603D10 (tigm) IST11095H3 (tigm)
Private Clones OST335907 (lexicon) OST258383 (lexicon) OST224314 (lexicon) OST179890 (lexicon)
OST173295 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30325
Vector Insertion
Chr 2: 181000519 - 181012827
Public Clones D007A03 (ggtc) D007E03 (ggtc) D007B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049032
Sequence
AGCGAAGGCTGCGGCCGCCACCGCCACCACCCGCCGCCGCACCCGTCACAGCCGGGCGCCGGAGCAGGCCCGTGTGGGCCCAG - UNI21290 - - U

NI30325 - GACTTCAGACTCTGGAGAAGTGACACTGCTGACTTCTGAGCCATGGCAACCCCAGATGTGAGCGTCCACATGGAGGAGGTGGTGGTTGTG

ACAACTCCAGACACTGCAGTTGATGGCAGTGGTGTAGAGGAAGTGAAGACAGTGCTTGTAACAACGAACCTAGCTCCTCATGG - UNI30325 - GGG

TGATTTGACAGAAGATAACATGGAAACAGAAAATGCAGCAGCTGCAGCTGCTGCTGCTTTTACAGCCTCCTCACAGCTCAAGGAAGCCGTGTTAG - UN

I30325 - TGAAGATGGCTGAAGAGGGGGAGAACTTAGAGGCTGAAATTGTGTACCCCATCACTTGCGGAGACAGCAGAGCTAACCTCATTTGGAGGAA

GTTTGTGTGCCCTGGCATCAATGTGAAATGTGTTCAG TATGATGAACATGTGATCAGCCCAAAGGAGTTTGTGCACCTGGCAGGGAAATCTACCTTGAA

GGATTGGAAGAGAGCCATCCGGATGAATGGCATCATGCTCAG GAAGATCATGGACTCTGGAGAGCTAGACTTCTACCAGCATGACAAGGTCTGCTCTAA

TACTTGCCGCAGCACGAAGATTGACCTTTCAGGGGCACGTGTATCCCTGAGCAGTCCTACATCCACAGAATACATCCCACTCACACCAGCTGCAGCTGAT

G TGAATGGCTCACCTGCCACCATCACCATAGAGACCTGTGAGGACCCTGGTGACTGGACCACAACCATTGGAG ATGACACATTTGCATTCTGGCGGGG

ATTAAAGGATGCGGGCTTACTGGATGAAGTCATACAGGAATTTCAACAGGAGCTAGAGGAAACCATGAAAGGCCTGCAGCAGCGAGTGCAGGACCCACCC

CTGCAGCTCCGAG ATGCTGTCCTCCTCAACAACATCGTGCAAAACTTTGGCATGCTGGATCTGGTGAAGAAGGTACTGGCCAGCCACAAGTGTCAGATG

GATCGTTCCCGGGAACAGTATGCACGGGACCTGGCAG CCCTGGAGCAGCAGTGTGATGAACATCGCCGCCGTGCCAAGGAGCTGAAGCACAAGTCCCAG

CACCTCAGCAATGTGCTCATGACGCTGACCCCGGTTCCATTGCCATCCCCTATGAAGCGGCCCCGTCTCGCCCGGGCTACATCTGGACCAGCTGCTATGG

CTTCCCAGGTGCTCACACAGTCTGCACAGATTGCTTTGAGTCCAGGAATGCCTGTGTCCCAGTTGACCAGTGTGCCACTGGGCAAAGTAGTATCTACACT

GCCCTCCACTGTCCTGGGCAAGGGCTCTCCTCAAGCTGCCCCAGCCAGTTCACCGGCCTCCCCACTGCTCGGAGGCTACACAGTTCTGGCCTCCTCTGGC

TCTACCTTCCCCAACGCAGTCGAGATCCATCCGGACACTTCCAGCCTCACAGTTTTGAGCACAGCCGCCATGCAGGATGGCAGCACAGTACTGAAGGTAG

TCAGCCCCTTGCAGCTGCTCACCCTGCCTGGCCTGGGACCCACCCTACAGAATGTGGCTCAGGCATCACCTGCAGGCAGCACCATTGTGACAATGCCTAC

AGCAACTGCCACTGGACCTGAGGAGCACACGGCCACTATTGAGGTGGCTGCTGTAGCAGAGGACCATGAGCAGAAGTAGCTGGCAGGGAGGGTAAAATCC

TTCCAAGATGGGCTGGCTGCCTCTCCTCAGGCCACTGCAGGCAGAGGCCACTACGGACACAGGCCACAGGGCTGGCTCAGCACAAGCAGGTCTGATGGGC

TGAACCAAAGAGAGGATTGCCGGATGAATCAAGAGAAGAAAAGGGGGCAGAATGTTGCCAGCAACCTGGAAAATCTGTCTTCAACATATAAACTTCCTCC

CCTTTTTTTGTGGGAAATACTCTTTTCCATCTGTTGCTTATTAATCCTGTTTACACATTGGGCCTTGAGCAGGAACCAGAGGGTCACTGACCAGGAGGAG

GCCTGGGTGCTTCTGGTACAGCTACAGAGCCAGCACCAGAGCCCAGCTAATTATAGGTCCTAGTGCCTGCACCCCCATGGGGCTGAGCCTGCTGGGACAT

TATTGACACATGTCTTAGGCAGCATGCCTGAGTGTGGAAGCCATAGATCCTATGGATTTGGTCTCTTCCCACAGTTCTCTGTTGGTTCAGTATGGCCAGT

GTCCATGTTCCTTCGCTGGTGGGAACATGCCCTGGGGATAAATGCAGACCCCAGTCAGGACCCCATCCCCACCCCACAGGCACTCAGGTGGTGAAGGGGT

CTCATGGACCTGGCATGTTCTAGACCCCTTTGCACATGGGCTGCAGGTGTTTTTAAGTGAATTGCTTAGTAGCCTTCTAGGGAAAAATCAAATTTATAGT

GTTTTCAACCAAAACAATGTTGAGTGCCTAGGCTCCTAAGTCAGTTCTAGGAGGGACCCAGGGCACCAATATATACACACCTAGCCAGGTGCTAGAGGTC

TTAAGTAGTGTCTTTCCCTGAGACAAAGCTCTGGAAGATTCTTGTGGAGGTATGCCTGAGACTTGGAATAGTTTAAATGACTCTCTGTGTGCAGCTGGCA

CTTGTACTCCCCTATGGTTGCCACCCCCCGCCCCGCCCCCCAATCTCTCCCTCTCCTGGAGGTGGAGCTAGGCCTCTCTGGCCAATACTCAGTGTCTCTA

TCCTGAGAGCTCCGGGGTATGTAAGGCTGTTTAGAGTGGTGGGTTGGTCAGCTGGAAGACAGGATCCAAAATGTTCCATGGAAGGCTGTCTTTAGGCTGT

TGGGCCTGTGCTAGGGGCTACCTAGGCAAGAGTTTTTGGAGCCAAACAATTCAGGGAACAAAGTTTTGGCCTCTTGGTAAAGGATGTCCTGGGATAGTCC

TAAGTTGTCTCTTGAATCTCCTGTTCTGTCAATTGAAGGCTTTCCTTTCAAGGGCCCCACAGCAGGAAGGGCCACTGTCCCATTTCACTGCTTTGAAGGC

TACCTTGTCCTTCCATCCATGCATCCCCTCGAGTGCCCAGATTGCTTTTACACCATTGCTGTGACTGGGCCCTTCCCTGCCCCTGCTCTCACCCCATGTC

ATGCTACTGAGGTTCTTGTTTTCCCTCTGTTCCATCACTGTTCACTGTGGCCACGAATCAGCTGGGTTTAGCAGATGTTTACCTGTTTATGTATATACTC

CTTTTTAAAAACTTGTTTTATTTTTTCATTGAGTTTCAAGTCCTGTTATATGCAGCTGTGTGACTTTAGGGGCATTGGGAGGACCAGCAGGGTGGGTACT

TCCTTGAAGTCCCTGCTCTACAAGCTCAGACTAGATTAATGTCACAAATAAAACCTTCCTGCCCTAGGAACCAAGAGTCTTTCCTTGGCACAAGCCCCAG

ATGTCATTTGCTTTGGGGGATGTGGGCCAGTTCCCTTTCTTCATAAGAGCAAGGTTGAAACATTTTTGGCCCTTGCCCCTTAGAGCATGGAGGTACTGGA

AGGTGAAATTTATTTCAGAGCCATACGAAAATAATTCTCAAATCAGCTTCAGAATTAGTTCATAGCACTCCTTCCCAGTATCCTCAGAGGCTGTCTACAG

CCTACCCTCCAAGGCAGCTTCTAGCAGGACAGAGAAGGACCAATAGTCCCGTCTGCATGGAACCCTCAGTTCTGGGAGAGGAAGTGTTATCACTGCCCCA

CCACCTGTTAGTACCTGCCTCTCTGGTTCCTACTGACTTCTATTGCTGTGTTCCCTGCTTGTTGGGCCATTTAGGACCCAGGAAGGAAGGTCTTCCCCCT

CCACATGCAAACACGGGTGCTTGTGGCTGCTTTCAGTTTGGTTTTCTGAAAAGATAGGACAGGATTTGGTTTTGCAGAGGGTGCAAGCTCCTTTCCATGC

CTGCCCAGGAGGCACGCAGAAGGGCAAGTTTGAGTTCTTTGAGTTCTACTTTGTATGTGTTTAGCAAGTATCTGCTTGGTACTTTGATTTAAAATAAAAA

CACTTTTATAA
Translation
 - UNI21290 - - UNI30325 - MATPDVSVHMEEVVVVTTPDTAVDGSGVEEVKTVLVTTNLAPHG - UNI30325 - GGDLTEDNMETENAA

AAAAAAFTASSQLKEAVLV - UNI30325 - VKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQ YDEHVISPKEFVHLAGKSTLKDW

KRAIRMNGIMLR RKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSTEYIPLTPAAADV VNGSPATITIETCEDPGDWTTTIGD DDTFAF

WRGLKDAGLLDEVIQEFQQELEETMKGLQQRVQDPPLQLRD DAVLLNNIVQNFGMLDLVKKVLASHKCQMDRSREQYARDLAA ALEQQCDEHRRRAKE

LKHKSQHLSNVLMTLTPVPLPSPMKRPRLARATSGPAAMASQVLTQSAQIALSPGMPVSQLTSVPLGKVVSTLPSTVLGKGSPQAAPASSPASPLLGGYT

VLASSGSTFPNAVEIHPDTSSLTVLSTAAMQDGSTVLKVVSPLQLLTLPGLGPTLQNVAQASPAGSTIVTMPTATATGPEEHTATIEVAAVAEDHEQK

For any suggestions or comments, please send an email to unitrap@crg.es