Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038718 (Pbx3)
Chromosomal location
Chr 2: 34027429 - 34227556 (-)
Description
pre B-cell leukemia transcription factor 3 Gene [Source:MGI (curated);Acc:Pbx3-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35075
Vector Insertion
Chr 2: 34079924 - 34226418
Public Clones IST14968C7 (tigm) IST12555A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113132
Sequence
TCCCCCTCCCCCTCCCCCTCTTTCTTCTCCTCCCTCGCCGCCGCCGCCGCTGCCGCCGCCGCCGCCTCAGCCTTCGCCTCCGCCGCCGCCGCCCGCTCCC

GCCCGCGCGCGGCGGGATGGACGATCAATCCAGGATGCTGCAGACTCTGGCCGGGGTGAACCTGGCCGGCCACTCGGTCCAGGGGGGTATGGCTCTGCCG

CCTCCCCCTCACGGCCACGAAGGGGCGGACGGCGACGGCAGGAAGCAGGACATCGGCGACATCCTCCACCAGATCATGACCATCACCGACCAGAGCTTGG

ACGAGGCGCAAGCAAA - UNI35075 - GAAACATGCTCTGAACTGTCACAGAATGAAACCGGCGCTCTTCAGCGTCTTGTGTGAGATCAAAGAGAAA

ACAG - UNI35075 - GTCTCAGCATCAGAGGAGCCCAGGAGGAAGACCCTCCCGACCCCCAGCTAATGAGACTGGACAATATGCTTTTGGCAGAAGG

GGTTTCAGGTCCTGAGAAAGGTGGGGGATCGGCGGCAGCAGCTGCAGCCGCGGCAGCCTCTGGAGGTTCTTCAGATAACTCTATTGAACACTCAGATTAC

AGAGCCAAATTGACCCAGATCAGACAAATCTATCACACAGAACTGGAGAAATATGAACAG - UNI35075 - GCATGTAATGAATTCACAACACATGT

GATGAACCTTCTCCGAGAACAGAGTAGAACGCGTCCCATTTCCCCGAAAGAGATCGAAAGGATGGTGGGCATCATCCATCGGAAATTTAGTTCCATTCAG

ATGCAGCTCAAGCAAAGCACGTGTGAAGCAGTTATGATTTTGAGATCAAGGTTCCTTGATGCCAG ACGGAAAAGGCGTAACTTCAGTAAACAGGCTACG

GAAATCTTGAATGAATATTTTTACTCACACCTCAGCAACCCCTACCCCAGTGAAGAAGCCAAAGAGGAGCTGGCCAAGAAATGCAGCATCACAGTATCAC

AG GTATCCAACTGGTTTGGCAACAAACGAATCAGGTACAAGAAGAACATCGGCAAATTTCAAGAGGAGGCCAATCTCTATGCTGCAAAAACAGCCGTGA

CAGCCGCACATGCAGTGGCTGCAGCCGTGCAGAACAACCAGACCAACTCACCCACCACGCCAAACTCTG GTGGATACCCTCCGTCATGTTATCAATCAG

ACGGGAGGCTACAGTGACGGCCTTGGAGCAAACTCACTGTACAGTCCACATAACTTAAAC GCTAATGGAGGCTGGCAGGACGCAACAACTCCATCTTCT

GTGACTTCTCCTACGGAAGGCCCGGGCAGTGTGCACTCGGATACCTCTAACTAATCCCCGGCGCTTTCCCAGCTGACATGCCTTGATAAGCGCATTTGGA

GCACTAGGAGAAGGAAAGCGTTTGTAACCCACCACCTACAGCTTTACTGTAACCCTGTCTTCTTAGAGAACTCGGGAAACCTGTTTTTTAAGGAATCATA

ATCATTTGTATTTAAACTTAAGACACACGTTTAAAAAGAAAGCACTTTATCCAATTAGGCCAAGATGTAACATTGTTGACACTTCTTTAACTGTTTCATC

CTAATTTATTATGGGTCTTTTACATTAATGGTTCCACAGTTGCCAGTTCCTTGGCCTTAAGGGTAAGAAGTACCATCTATGCTAGACCCCAATTATAGAG

CAGGCAAGGTTCACCCTGCCTAAGCTGAACCCTTGCGGATTTCCATGCAGGCTCTCATCATCGTTCTCATATCACGGATGGGCTTGGAGGGAAGGCGATG

TCTGCCTGTCTTCTTAAGGAAGGCATTTCAGGACTTCCCTTGCCATGTTTGTGTTGCCATCTCTTATGTTGTAATTAGGTCAAAGACTGGTGGCCTCCTT

TCTCCCTCTGAAGTACCAGAGCCTGGAGTCTGCGCTAATGAGACCATGGATCCAGATTGCCCTAAGATGAAGATCTTGCTGCTACAGAGGTGAAAACAAG

ACCTGTCTGGGGTTTGACCGTGTGCGCTAGGTGCTGCACAGACTTGTCAAGGTGTGCTCTTCCTCTGGGCAGCCTGGAAAGGCCCTGCTCTCTGGAGTGC

TGTATATAGTGTAGCAAAAGAGTATTTATACATCCCACCAATCAAAACACAGCTTTATTACCTCATGCGAACTCATACAAACCAATAGAATCCCAACATG

TTCTGTAGCTTAGAGCGCTCACTTACTACCTCTGAACAATACTCACGCTGTAGTTTGTCTCTTTCTTATCTTTTTTGCATCTTGTAATTAACTCTTTGTT

TCCCTTCACAAAATGTAATGTACATT
Translation
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAK - UNI35075 - KKHALNCHRMKPALFSVLC

EIKEKTG - UNI35075 - GLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKY

EQ - UNI35075 - ACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDAR RRKRRNFSKQATEILNEYF

YSHLSNPYPSEEAKEELAKKCSITVSQ VSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSG GGYPPSCYQSDGRLQ

 
Transcript ENSMUST00000040638
Sequence
TCCCCCTCCCCCTCCCCCTCTTTCTTCTCCTCCCTCGCCGCCGCCGCCGCTGCCGCCGCCGCCGCCTCAGCCTTCGCCTCCGCCGCCGCCGCCCGCTCCC

GCCCGCGCGCGGCGGGATGGACGATCAATCCAGGATGCTGCAGACTCTGGCCGGGGTGAACCTGGCCGGCCACTCGGTCCAGGGGGGTATGGCTCTGCCG

CCTCCCCCTCACGGCCACGAAGGGGCGGACGGCGACGGCAGGAAGCAGGACATCGGCGACATCCTCCACCAGATCATGACCATCACCGACCAGAGCTTGG

ACGAGGCGCAAGCAAA - UNI35075 - GAAACATGCTCTGAACTGTCACAGAATGAAACCGGCGCTCTTCAGCGTCTTGTGTGAGATCAAAGAGAAA

ACAG - UNI35075 - GTCTCAGCATCAGAGGAGCCCAGGAGGAAGACCCTCCCGACCCCCAGCTAATGAGACTGGACAATATGCTTTTGGCAGAAGG

GGTTTCAGGTCCTGAGAAAGGTGGGGGATCGGCGGCAGCAGCTGCAGCCGCGGCAGCCTCTGGAGGTTCTTCAGATAACTCTATTGAACACTCAGATTAC

AGAGCCAAATTGACCCAGATCAGACAAATCTATCACACAGAACTGGAGAAATATGAACAG - UNI35075 - GCATGTAATGAATTCACAACACATGT

GATGAACCTTCTCCGAGAACAGAGTAGAACGCGTCCCATTTCCCCGAAAGAGATCGAAAGGATGGTGGGCATCATCCATCGGAAATTTAGTTCCATTCAG

ATGCAGCTCAAGCAAAGCACGTGTGAAGCAGTTATGATTTTGAGATCAAGGTTCCTTGATGCCAG ACGGAAAAGGCGTAACTTCAGTAAACAGGCTACG

GAAATCTTGAATGAATATTTTTACTCACACCTCAGCAACCCCTACCCCAGTGAAGAAGCCAAAGAGGAGCTGGCCAAGAAATGCAGCATCACAGTATCAC

AG GTATCCAACTGGTTTGGCAACAAACGAATCAGGTACAAGAAGAACATCGGCAAATTTCAAGAGGAGGCCAATCTCTATGCTGCAAAAACAGCCGTGA

CAGCCGCACATGCAGTGGCTGCAGCCGTGCAGAACAACCAGACCAACTCACCCACCACGCCAAACTCTG GTTCTTCTGGTTCTTTTAACCTCCCAAATT

CTGGGGACATGTTCATGAACATGCAGAGTCTGAATGGGGATTCTTACCAAGGGTCCCAAGTCGGAGCCAATGTGCAGTCACAG GTGGATACCCTCCGTC

ATGTTATCAATCAGACGGGAGGCTACAGTGACGGCCTTGGAGCAAACTCACTGTACAGTCCACATAACTTAAAC GCTAATGGAGGCTGGCAGGACGCAA

CAACTCCATCTTCTGTGACTTCTCCTACGGAAGGCCCGGGCAGTGTGCACTCGGATACCTCTAACTAATCCCCGGCGCTTTCCCAGCTGACATGCCTTGA

TAAGCGCATTTGGAGCACTAGGAGAAGGAAAGCGTTTGTAACCCACCACCTACAGCTTTACTGTAACCCTGTCTTCTTAGAGAACTCGGGAAACCTGTTT

TTTAAGGAATCATAATCATTTGTATTTAAACTTAAGACACACGTTTAAAAAGAAAGCACTTTATCCAATTAGGCCAAGATGTAACATTGTTGACACTTCT

TTAACTGTTTCATCCTAATTTATTATGGGTCTTTTACATTAATGGTTCCACAGTTGCCAGTTCCTTGGCCTTAAGGGTAAGAAGTACCATCTATGCTAGA

CCCCAATTATAGAGCAGGCAAGGTTCACCCTGCCTAAGCTGAACCCTTGCGGATTTCCATGCAGGCTCTCATCATCGTTCTCATATCACGGATGGGCTTG

GAGGGAAGGCGATGTCTGCCTGTCTTCTTAAGGAAGGCATTTCAGGACTTCCCTTGCCATGTTTGTGTTGCCATCTCTTATGTTGTAATTAGGTCAAAGA

CTGGTGGCCTCCTTTCTCCCTCTGAAGTACCAGAGCCTGGAGTCTGCGCTAATGAGACCATGGATCCAGATTGCCCTAAGATGAAGATCTTGCTGCTACA

GAGGTGAAAACAAGACCTGTCTGGGGTTTGACCGTGTGCGCTAGGTGCTGCACAGACTTGTCAAGGTGTGCTCTTCCTCTGGGCAGCCTGGAAAGGCCCT

GCTCTCTGGAGTGCTGTATATAGTGTAGCAAAAGAGTATTTATACATCCCACCAATCAAAACACAGCTTTATTACCTCATGCGAACTCATACAAACCAAT

AGAATCCCAACATGTTCTGTAGCTTAGAGCGCTCACTTACTACCTCTGAACAATACTCACGCTGTAGTTTGTCTCTTTCTTATCTTTTTTGCATCTTGTA

ATTAACTCTTTGTTTCCCTTCACAAAATGTAATGTACATT
Translation
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAK - UNI35075 - KKHALNCHRMKPALFSVLC

EIKEKTG - UNI35075 - GLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKY

EQ - UNI35075 - ACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDAR RRKRRNFSKQATEILNEYF

YSHLSNPYPSEEAKEELAKKCSITVSQ VSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSG GSSGSFNLPNSGDMF

MNMQSLNGDSYQGSQVGANVQSQ VDTLRHVINQTGGYSDGLGANSLYSPHNLN ANGGWQDATTPSSVTSPTEGPGSVHSDTSN

For any suggestions or comments, please send an email to unitrap@crg.es