Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038733 (Wdr26)
Chromosomal location
Chr 1: 183107492 - 183141568 (-)
Description
WD repeat domain 26 Gene [Source:MGI Symbol;Acc:MGI:1923825]
RefSeq_dna
NM_145514 
RefSeq_peptide
NP_663489.3 
UniGene
Mm.289082 
MGI
MGI:1923825 
Uniprot/SWISSPROT
Q8C6G8 
Uniprot/SPTREMBL
B2RTG7 
Human Ortholog
ENSG00000162923 (WDR26)
Omim not available
UniTrap UNI28209
Vector Insertion
Chr 1: 183139444 - 183141206
Public Clones not available
Private Clones OST37148 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24153
Vector Insertion
Chr 1: 183139239 - 183139343
Public Clones not available
Private Clones OST232704 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1034
Vector Insertion
Chr 1: 183133292 - 183139133
Public Clones AY0423 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27698
Vector Insertion
Chr 1: 183127863 - 183128977
Public Clones not available
Private Clones OST52872 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3274
Vector Insertion
Chr 1: 183122031 - 183127705
Public Clones AG0616 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36353
Vector Insertion
Chr 1: 183116078 - 183117878
Public Clones IST14537F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11851
Vector Insertion
Chr 1: 183107963 - 183111434
Public Clones A071C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27913
Vector Insertion
Chr 1: 183107491 - 183107963
Public Clones not available
Private Clones OST44518 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036329
Sequence
ATGCAGGCCAACGGGGCGGGAGGAGGCGGCGGCGGGGGCGGCGGGGGCCAGGGCCAGACCCCGGAGCTCGCCTGCCTGTCGGCGCAGAACGGGGAGTCGT

CCCCTTCGGCGACGTCCGCGGGGGACCTGGCCCACGCCAACGGGCTCCTGCCTGCCGCCCCCTCCGCCGCTGGCAACAATAGCAACAGCCTGAGTGTCAA

TAACGGGGTTCCCGGCGGGGCCGCCGCGGCCTCCGCCACCGCCGCCGCCGCCCAGGCCACCCCCGAGCTGGGCAGCAGCCTCAAGAAGAAGAAGCGGCTC

TCGCAGTCCGATGAGGATGTCATTAGGCTCATAGGACAGCACCTCAATGGCCTAGGGCTCAA - UNI28209 - CCAGACTGTTGATCTCCTCATGCA

AGAGTCAGGATGTCGTTTAGAGCATCCTTCTGCTACCAAATTCCGAAATCATGTCATGGAAGGAGACTGGGATAAG - UNI24153 - GCAGAGAATG

ACCTGAATGAGCTAAAGCCTTTAGTGCATTCTCCTCACGCTATTGTGGTAAGAGGCGCACTTGAAATCTCTCAAACGTTGTTGGGAATAATTGTG - UN

I1034 - AGGATGAAGTTTCTGCTGCTGCAGCAGAAGTACCTGGAATACCTGGAGGACGGCAAGGTCCTGGAGGCACTTCAAGTTCTACGCTGCGAACT

GACGCCGTTGAAATACAACACCGAGCGCATCCATGTCCTTAGTGG GTATCTGATGTGCAGCCATGCCGAAGACCTACGGGCAAAAGCTGAATGGGAAGG

CAAGGGCACAGCGTCCCGGTCCAAACTGCTGGACAAGCTTCAGA - UNI27698 - CCTATTTACCACCATCAGTGATGCTTCCCCCACGGCGTTTAC

AGACTCTCCTGCGGCAGGCGGTGGAACTACAAAGGGATCGGTGCCTATATCACAATACCAAACTTGACAATAATCTAGATTCTGTGTCTCTACTTATAGA

TCATGTTTGTAGTAG - UNI3274 - GAGGCAGTTTCCCTGTTACACTCAACAGATACTTACAGAGCATTGTAATGAAGTGTGGTTCTGTAAATTTTC

TAATGATGGCACTAAACTAGCAACAGGATCAAAGGATACCACAGTTATCATATGGCAAGTTGATCCG - UNI36353 - GATACGCACCTGTTAAAAC

TGCTTAAAACGTTAGAAGGACATGCGTATGGTGTCTCTTATATAGCATGGAGTCCAGATGACAGCTATCTTGTTGCTTGTGGTCCAGATGACTGCTCTGA

GCTTTGGCTTTGGAATGTACAG - UNI36353 - ACGGGAGAATTAAGAACAAAAATGAGCCAATCTCATGAAGACAGTTTGACCAGTGTGGCCTGGA

ATCCAGATGGGAAACGCTTTGTGACGGGAGGTCAGCGTGGTCAGTTCTACCAGTGT - UNI36353 - GACCTGGACGGAAATCTTCTGGACTCCTGG

GAAGGAGTGCGAGTACAGTGCCTGTGGTGCTTGAGTGACGGGAAGACTGTGCTGGCTTCCGACACGCACCAGAGAGTCCGGGGCTACAACTTTGAGGACC

TGACAGATAGAAACAT AGTACAGGAAGATCATCCTATTATGTCATTTACTATTTCCAAAAATGGCCGATTAGCTTTGTTAAATGTAGCAACTCAG GGA

GTTCATTTATGGGACTTGCAAGACAGAGTTTTAGTAAGGAAATATCAAGGTGTTACCCAAGGGTTTTATACAATCCACTCGTGTTTTGGAGGCCATAATG

AAGACTTCATTGCTAGTGGCAGCGAAG ATCACAAGGTTTACATCTGGCACAAACGTAGTGAACTGCCAATTGCGGAGCTCACAGGGCACACGCGCACAG

TAAATTGTGTTAGCTGGAACCCACAGATTCCATCCATGATGGCCAGTGCCTCAGACGATGGCACTGTTAGAATATGGGGACCAGCACCTTTCATAGACCA

CCAGAATATTGAAG - UNI11851 - - UNI27913 - AGGAATGCAGTAGCATGGATAGTTGATGGCAAATTTGGAGCAGACGACTTCTGTTTAAC

TTAAAATTAGTCGTATTTTAATGGCTTGGGATTTGGTGCAAACAAACATGATTGATAGCTGGACAGACATGCTCGTCATGAAAAAAAAAAAAAAAGAACC

ATTTTGAAGCCCGATTGGGGCCAAACATTTACACCTTGCTTCCTAGTAACCAGTTGATGAAGCGCGTCTAGAACGTTGTTGGACACCATGTTGAATTATT

CCCCATCGGTTGTGAAGAACTGTGCTACATTCAGGCTTACCCATTGAACTCAGTATATATATTTTTTCCCTCCTGCCTTTTGTCTGGTGGGACACCATTC

TTGTTGCTCTTCTGTGTAATGAAGTTCAAATGCTTGTTTGGAAACTTTATTTAACAGTTTAGAAGGCTTGATAGGAAGAGGTCATTAGTCTGAAGAGTAT

ACATTGGACAGG
Translation
MQANGAGGGGGGGGGGQGQTPELACLSAQNGESSPSATSAGDLAHANGLLPAAPSAAGNNSNSLSVNNGVPGGAAAASATAAAAQATPELGSSLKKKKRL

SQSDEDVIRLIGQHLNGLGLN - UNI28209 - NQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDK - UNI24153 - AENDLNELKPLVHSPHA

IVVRGALEISQTLLGIIV - UNI1034 - RMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSG GYLMCSHAEDLRAKAEWEGKGT

ASRSKLLDKLQT - UNI27698 - TYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSR - UNI3274 - RRQFPCYT

QQILTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDP - UNI36353 - DTHLLKLLKTLEGHAYGVSYIAWSPDDSYLVACGPDDCSELWLWNVQ

 - UNI36353 - TGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQC - UNI36353 - DLDGNLLDSWEGVRVQCLWCLSDGKTVLASDT

HQRVRGYNFEDLTDRNI IVQEDHPIMSFTISKNGRLALLNVATQ GVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSED DHKVYIWHK

RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEE - UNI11851 - - UNI27913 - EECSSMDS
Transcript ENSMUST00000111053
Sequence
TCGCCTGCCTGTCGGCGCAGAACGGGGAGTCGTCCCCTTCGGCGACGTCCGCGGGGGACCTGGCCCACGCCAACGGGCTCCTGCCTGCCGCCCCCTCCGC

CGCTGGCAACAATAGCAACAGCCTGAGTGTCAATAACGGGGTTCCCGGCGGGGCCGCCGCGGCCTCCGCCACCGCCGCCGCCGCCCAGGCCACCCCCGAG

CTGGGCAGCAGCCTCAAGAAGAAGAAGCGGCTCTCGCAGTCCGATGAGGATGTCATTAGGCTCATAGGACAGCACCTCAATGGCCTAGGGCTCAA - UN

I28209 - CCAGACTGTTGATCTCCTCATGCAAGAGTCAGGATGTCGTTTAGAGCATCCTTCTGCTACCAAATTCCGAAATCATGTCATGGAAGGAGAC

TGGGATAAG - UNI24153 - GCAGAGAATGACCTGAATGAGCTAAAGCCTTTAGTGCATTCTCCTCACGCTATTGTGGTAAGAGGCGCACTTGAAAT

CTCTCAAACGTTGTTGGGAATAATTGTG - UNI1034 - AGGATGAAGTTTCTGCTGCTGCAGCAGAAGTACCTGGAATACCTGGAGGACGGCAAGGT

CCTGGAGGCACTTCAAGTTCTACGCTGCGAACTGACGCCGTTGAAATACAACACCGAGCGCATCCATGTCCTTAGTGG GTATCTGATGTGCAGCCATGC

CGAAGACCTACGGGCAAAAGCTGAATGGGAAGGCAAGGGCACAGCGTCCCGGTCCAAACTGCTGGACAAGCTTCAGA - UNI27698 - CCTATTTAC

CACCATCAGTGATGCTTCCCCCACGGCGTTTACAGACTCTCCTGCGGCAGGCGGTGGAACTACAAAGGGATCGGTGCCTATATCACAATACCAAACTTGA

CAATAATCTAGATTCTGTGTCTCTACTTATAGATCATGTTTGTAGTAG - UNI3274 - GAGGCAGTTTCCCTGTTACACTCAACAGATACTTACAGA

GCATTGTAATGAAGTGTGGTTCTGTAAATTTTCTAATGATGGCACTAAACTAGCAACAGGATCAAAGGATACCACAGTTATCATATGGCAAGTTGATCCG

 - UNI36353 - GATACGCACCTGTTAAAACTGCTTAAAACGTTAGAAGGACATGCGTATGGTGTCTCTTATATAGCATGGAGTCCAGATGACAGCTA

TCTTGTTGCTTGTGGTCCAGATGACTGCTCTGAGCTTTGGCTTTGGAATGTACAG - UNI36353 - ACGGGAGAATTAAGAACAAAAATGAGCCAAT

CTCATGAAGACAGTTTGACCAGTGTGGCCTGGAATCCAGATGGGAAACGCTTTGTGACGGGAGGTCAGCGTGGTCAGTTCTACCAGTGT - UNI36353

 - GACCTGGACGGAAATCTTCTGGACTCCTGGGAAGGAGTGCGAGTACAGTGCCTGTGGTGCTTGAGTGACGGGAAGACTGTGCTGGCTTCCGACACGC

ACCAGAGAGTCCGGGGCTACAACTTTGAGGACCTGACAGATAGAAACAT AGTACAGGAAGATCATCCTATTATGTCATTTACTATTTCCAAAAATGGCC

GATTAGCTTTGTTAAATGTAGCAACTCAG GGAGTTCATTTATGGGACTTGCAAGACAGAGTTTTAGTAAGGAAATATCAAGGTGTTACCCAAGGGTTTT

ATACAATCCACTCGTGTTTTGGAGGCCATAATGAAGACTTCATTGCTAGTGGCAGCGAAG ATCACAAGGTTTACATCTGGCACAAACGTAGTGAACTGC

CAATTGCGGAGCTCACAGGGCACACGCGCACAGTAAATTGTGTTAGCTGGAACCCACAGATTCCATCCATGATGGCCAGTGCCTCAGACGATGGCACTGT

TAGAATATGGGGACCAGCACCTTTCATAGACCACCAGAATATTGAAG - UNI11851 - - UNI27913 - AGGAATGCAGTAGCATGGATAGTTGA

TGGCAAATTTGGAGCAGACGACTTCTGTTTAACTTAAAATTAGTCGTATTTTAATGGCTTGGGATTTGGTGCAAACAAACATGATTGATAGCTGGACAGA

CATGCTCGTCATG
Translation
 - UNI28209 - MQESGCRLEHPSATKFRNHVMEGDWDK - UNI24153 - AENDLNELKPLVHSPHAIVVRGALEISQTLLGIIV - UNI1034

 - RMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSG GYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQT - UNI27698 - TY

LPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSR - UNI3274 - RRQFPCYTQQILTEHCNEVWFCKFSNDGTKLATGSK

DTTVIIWQVDP - UNI36353 - DTHLLKLLKTLEGHAYGVSYIAWSPDDSYLVACGPDDCSELWLWNVQ - UNI36353 - TGELRTKMSQSHED

SLTSVAWNPDGKRFVTGGQRGQFYQC - UNI36353 - DLDGNLLDSWEGVRVQCLWCLSDGKTVLASDTHQRVRGYNFEDLTDRNI IVQEDHPIMS

FTISKNGRLALLNVATQ GVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSED DHKVYIWHKRSELPIAELTGHTRTVNCVSWNPQIPSM

MASASDDGTVRIWGPAPFIDHQNIEE - UNI11851 - - UNI27913 - EECSSMDS

For any suggestions or comments, please send an email to unitrap@crg.es