Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038764 (Ptpn3)
Chromosomal location
Chr 4: 57203713 - 57314709 (-)
Description
protein tyrosine phosphatase, non-receptor type 3 Gene [Source:MGI (curated);Acc:Ptpn3-001]
RefSeq_peptide
NP_035337.1 
UniGene
Mm.436893 Mm.439128 Mm.462295 
MGI
MGI:105307 
Uniprot/SWISSPROT
A2ALK8 
Uniprot/SPTREMBL
A2ALK9 A2ALL0 A2ALL1 Q14BS5 Q62133 Q8BWC1 
Human Ortholog
ENSG00000070159 (PTPN3)
Omim not available
UniTrap UNI29636
Vector Insertion
Chr 4: 57282894 - 57313218
Public Clones (sanger) E078A10 (ggtc) 5SE305B04 (ggtc) E046B10 (ggtc) E130E04 (ggtc)
IST11520E10 (tigm) IST10030F9 (tigm) IST10151A8 (tigm) IST14688B6 (tigm)
IST11660A3 (tigm) IST11376B1 (tigm) IST14799H10 (tigm) IST11908E8 (tigm)
IST14281A5 (tigm) IST10005H9 (tigm) IST10033H3 (tigm) IST12107G8 (tigm)
IST14124F6 (tigm) IST15108C4 (tigm) IST11041F7 (tigm) IST14318D8 (tigm)
IST15078E3 (tigm) IST14170D2 (tigm) IST14996G12 (tigm) IST11859E6 (tigm)
IST10655D10 (tigm) IST14942E5 (tigm) IST12330A11 (tigm) IST14784D2 (tigm)
IST14813G9 (tigm) IST12706B7 (tigm) IST13639C12 (tigm) IST11711G9 (tigm)
IST11222H3 (tigm) IST14175G9 (tigm) IST10601A8 (tigm) IST15045C2 (tigm)
IST14942E6 (tigm) IST12502E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18585
Vector Insertion
Chr 4: 57282894 - 57283050
Public Clones not available
Private Clones OST420211 (lexicon) OST390549 (lexicon) OST364607 (lexicon) OST354903 (lexicon)
OST317108 (lexicon) OST297388 (lexicon) OST293003 (lexicon) OST284510 (lexicon)
OST281658 (lexicon) OST276258 (lexicon) OST274448 (lexicon) OST260244 (lexicon)
OST238564 (lexicon) OST215936 (lexicon) OST195025 (lexicon) OST169030 (lexicon)
OST165614 (lexicon) OST132219 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26593
Vector Insertion
Chr 4: 57277781 - 57277854
Public Clones not available
Private Clones OST109138 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI700
Vector Insertion
Chr 4: 57262901 - 57267788
Public Clones DB0257 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3610
Vector Insertion
Chr 4: 57261618 - 57262779
Public Clones BA0534 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4534
Vector Insertion
Chr 4: 57257936 - 57261529
Public Clones AT0920 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4472
Vector Insertion
Chr 4: 57252573 - 57253657
Public Clones AA0056 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3765
Vector Insertion
Chr 4: 57236548 - 57238377
Public Clones XR0985 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4750
Vector Insertion
Chr 4: 57219177 - 57231380
Public Clones AX0338 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2339
Vector Insertion
Chr 4: 57209369 - 57210377
Public Clones AD0858 (sanger) RRR573 (baygenomics) RRS555 (baygenomics) RRR012 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075637
Sequence
AGGACTCCGGGCTCTGTAGGAATTCCCCGGACGCGAGGTTCTGGCGGCGCCTGCAGCGGTGCACTACCTTGGGACAGAGACCGGGATCTAAGCCAGGAAG

TCAGGCACGGCTGAGGGTCTCGTGGTGACATGGGAACAAAAGGTTCTCGGGATATCTAGCACCCAG - UNI18585 - - UNI29636 - GTTACTC

GGCGGCCGTTATGACCTCCCGGTTACGTGCGTTGGGTGGAAGAATTAACAATACCCGAACCTCTGAATTGCCCAAAGAGAAAACTCGATCCGAGGTCATC

TGCAGCATACGGTTTTTAGATGGCTTGGTACAGACCTTTAAAGTTAAC - UNI18585 - - UNI29636 - AAACAAGATTTGGGCCAGTCGCTTC

TGGATATGGCCTATGGCCACCTGGGTGTGACGGAGAAGGAATACTTCGGCTTGCAACATGGCGACGACCCAGTGGACTCTCCT - UNI26593 - AGA

TGGCTTGAGGCAAGCAAACCCCTCAGGAAGCAGCTGAAAG GAGGTTTTCCCTGTACCCTGCATTTTCGAGTAAGATATTTTATACCTGATCCCAACACA

CTGCAGCAGGAGCAAACCAG GCATCTATATTTCTTACAACTGAAGATGGATGTTTGCGAAGGAAG GTTAACCTGCCCTCTCAACTCAGCGGTGGTTCT

AGCCTCGTACGCAGTACAAT - UNI700 - CTCATTTTGGAGACTTTAATTCTTCAATACATCATCCAGGCTATCTTGCCGACAGCCAGTTCATACCA

GATCAAAATGATGACTTTTTAAGCAAGGTGGAGTCACTCCATGAACAGCACAG - UNI3610 - TGGGCTAAAGCAGTCGGAAGCCGAATCTTGCTAC

ATCAACATAGCTCGAACCCTTGACTTCTACGGAGTGGAGCTTCATGGAGGCAGA - UNI4534 - GATCTGCACAACCTAGATCTAATGATCGGGATT

GCGTCTGCAGGCATTGCAGTCTACCGAAAATACATTTGCACAAGTTTCTACCCTTG GGTGAACATACTCAAAATTTCTTTCAAAAGGAAAAAGTTCTTC

ATACACCAGCGGCAAAAACAG - UNI4472 - GCTGAATCCAGGGAACATATCGTGGCCTTCAACATGCTGAATTACCGATCTTGCAAAAACTTGTGG

AAATCCTGCGTCGAACACCATTCGTTCTTTCAGGCAAAAAAGTTACTACCTCAGGAAAAGAATGTTCTCTCTCAGTACTGGACTCTAGGCTCCAGGAACC

CCAAAAA GTCTGTAAATAACCAATATTGCAAAAAGGTGATTGGAGGGATGGTGTGGAACCCAGTCATGAGGAGGTCCTTATCAGTGGAACGGCTGGAAA

CCAAGAGCCTGCCTTCCCGGTCCCCTCCCATCACCCCCAACTG GCGAAGTCCTCGGCTCCGGCATGAAATCCGCAAGCCCCGCCATTCCTCCGCGGACA

ACCTGGCCAATGAGATGACCTACATCACAGAAACCGAGGATGTGTTCTATACCTACAAGGGACCCCTGTCCCCCAAAGACAGCGACTCTGAAGTCTCCCA

GAACCACAGCCCACACCGGGA GAGTTTGTCCGAAAACAACCCAGCCCAAAGCTGCCTGACCCAGAAGTCATCCAGTTCTGTGTCTCCATCTTCGAATGC

TCCAGGCTCCTGCTCTCCAGATGGAGTTGACCAGCGGTTCTTAGAAGACTACCACAAGGTGACCAAAGGGGGGTTCGTCGAGGACGCCAGCCAGTACTAC

TGTGATAAG AGTGACGATGGAGATGGCTACCTAGTCCTGATCCGGATCACACCAGATGAAGAGGGAAGATTTGGCTTTAACCTTAAG - UNI3765 -

 GGAGGAGTGGATCAAAAGATGCCGCTCGTGGTCTCGAGGATAAACCCAGAGTCACCT GCAGATACCTGCATGCCTAAGCTGAATGAGGGGGATCAGAT

CGTGTTGATCAATGGCCGGGACATCTCAGAGCACACTCATGACCAGGTGGTGATGTTCATCAAAGCAAGCCGGGAGTCCCACTCGAGAGAACTGGCCCTG

GTGATCAGGAGAAAAG CTGTGCGCTCGCTGGCGGAGATCAGATCAGAAGATGAGCTGAGTCAGCTTTTCCCAGAAGCCATGTTTCCTGCATGTCCTGAG

GGTGGGGACAGTCTGGAGGGATCCATGGAGCTGCTGAAGAAAGGTCTGGAAAGCGGTACAGTGTTGATCCAGTTTGAG - UNI4750 - CAACTCTAC

AGAAAGAAGCCCGGCTTAGCCGTCTCATTTGCAAAGCTGCCTCAGAATTTGGATAAAAACCGATACAAAGATGTGTTGCCTT ATGATACCACGCGGGTA

TTATTGCAGGGAAATGAAGATTACATTAATGCCAGTTATGTGAAC ATGGAGATGCCCGCTGCTAACCTTGTGAACAAGTACATTGCCACTCAGGGACCG

CTGCCAAACACCTGTGCACAGTTTTGGCAAGTTGTCTGGGATCAGAAGTTGTCTCTTGTTGTCATGCTGACGACTCTCACCGAGCGAGGGCGG ACCAAA

TGTCACCAGTACTGGCCGGATCCCCCTGACATCATGGACCATGGCATCTTTCACATCCAGTGTCAGACAGAGGACTGTACCATTGCTTACGTGTCCCGAG

AAATGCTAGTTACAAACACGGAG - UNI2339 - ACCGGGGAAGAACACACAGTGACCCATCTCCAGTATGTGGCGTGGCCTGACCACGGCGTACCTG

ATGACTCATCAGACTTCCTGGAGTTTGTGAAGTATGTGAGGTCCCTGAGGGTCGACGGTGAGCCTGCCCTCGTTCACTGCAG TGCTGGAATAGGTCGGA

CAGGTGTTTTAGTCACTATGGAAACAGCCATGTGCTTAATTGAGAGGAACCTGCCTGTTTACCCACTGGATATTGTCCGGAAAATGAGAGACCAGCGCGC

GATGATGGTGCAGACGTCA AGCCAATACAAGTTTGTGTGTGAAGCGATCCTTCGAGTGTACGAAGAAGGCTTAGTCCAGAGGCTGGATCCCAGTTAGGA

CAACTGTGAAGTGGTCGTTCCTCCTTCCCTAGGGCGACTTCCTGAAGAAGGGGGCACACATTCCCCTGGAGGCCCCCCCAGAGATGCTGGTCACTGTGGG

AAAGGGATGAGCTTATCTGAACCCAGGCACTTTAAATTTCTGTGGAAAAGATACCCTGTACATAAGGACTGATGGTGTAGATATGCATGCAGCTATGACT

CCTTTGGCCCAGAGAGAAGCAACAGGGGATCTCCAGTTGGGAACTGTGTTTCTCCCTACATATCACCGTCCCCTGTCATCCATCCTTGAGCAATGAGAGG

GGACACCAGCAGTGTCCTCCCGCCAGAAGCCAGACAATGTGGCTACTTGTGGTTGCTCAGGTGTTTTGTGTGTTGTTCTGTGTGGGATTCCAAGGGCTGA

ACTTCCTTGGCAATTCCTGTCCATTACCCCTGACACCAAGGGAAACTCGGATGAATGTACCACAGGCAGGGCACAAGGGACTTCAGGCTGGAGGATGAAC

AGGATCTATTCTGCCCGCCCTCCCTCCCTCCCTCCCTCCCTCCGCCTCATCTCTACCCCTTCTGCAATCCAAAGCACCCCATTTCCCCCACCCCAAATTC

CTTTTCTTCAGGATCACGCCCAGTGCCTGAACCAGCTTCATGATGTATGTTCAGGTGAATTCTCTGCCGAGACTGGGAACTAGGCTCTGCATAAGGCTGA

GTCTCAGCTTCGGAAGCAGGCGAGCCTCTGCTCACTCCTTGTATACTCGGACGCCATGACTGGATTCGCCGACTACTGAATCTCTGGATTGCTGCTACTT

CAAGCTCTCACACTTGAAACAAGACAATTTTCTTGGGGGGTGGGGGATGATAGCATCCAAATATTCAGAATTTTGGACCCTTCTTAGAAATGACCTTCTA

GTAAGTGACCATGAGAAACACTGCTTCTCAATCAAGGGTGGTGTGTGTGTGTGTGTCCGTCTGTCATTGTGTCTCTGTGTGTATGTGTGTGTCTGTGGGT

GGCTGACTTTCTCAGGATTCCTAACTTGATTCAAATTACTGTTGAGTTTATGTAAAGAATTCATCTCTGTACAGAAGAACAAGTGTGTTGTTCATTCACC

CTAGGTTACAATGGTCTCCATTTCATTTCAGAGGAGAGAATCAGACTAACTGAATATAAACACAATTTGATGTTAATTTATTCTAAGTACTCTGGGATTT

TGATTGTCCTAAAGAATTCTGCTCTGTGAATACCATGTTATTTTTTTTTTTTAATTTGTGGCAGGATTGTAGCGAATTACTATTTAAGGAAAATAAATTA

CATGAATGCTCTAAGGTGGTATTTTTAAATAGCTGTTTTTATGTATCGAAAAGAAAGTCAGCAAGTTTCTTAATGGTATTATAGGAAAAGGATACTTTGA

TGTTATAATGTATGTAGATGAAGCTACATAGATACTTAGCAGATACTGGACCAATTAAAGCATTTCCTAGTTGCAAGATGGGTAAGGACCTGTACAAAGG

ACCTCAGGTTTTTGAAGGTTCTTTATCTGCAGGCTCAGTTTATCTGTCTACTTCCCTCCCCCCTGTCTTTTACCCACAAACATCTTAGTAGTGCTCAATG

ATGTGAGTGAGAAAGGCACTGCTCAGTGCCCTGTATACTGAGAAAGTGGAATTTGGTTCTGTACTGCTCAACACCAGGTAGCCCTCATAGGAACCTGGGA

TCGATCTGTGCCTCTCTTTCCGTCTGTGTGAAATAATGAAAAACAACACTTGGAATTTGAGGACAGAATTAGATCACACTATGGAAACTAATTTCCAGCT

TCTGGAATACATAAACCAATGCCACTGAAGAACTAGGAAGGCTGGCTTCTTTTGTTGGCCCCAAGCATATCAGACAAGTGGAACCCACCAGGTTTTCATA

GAGCAGTGTTGTAGAGGGAAAAGCACAGAGCACCGATACCTTTATTCAAGCTGGGTTCTGAGAACGCTCTCAGTAAAGCCCCAAGAAGAGGAGGAGGAGA

GAGTACTGGGTGCATTTCAGTGGCACTAGGCTGTTTAACAGACGACCGTTGTTTGATAGCAATGTTTATCACTGCCCTGTGTGCAAAGCACTTGCAGAAT

CTAAATGTCCTTGGAGACTGTTTTATTATTTTTCTGAAAACACGTTGAGTGTGGTCACGAAAATGCTGCTGTTACACTTATGTAATATTCTGTGAAGCTT

GAAAAAGCTGCAGCTGGCCTCTCTCTGCCATTGTATGGGGCCAGCACTTCAGACACAGTGGTAGTTGCCAGAAACAGAGTCCGTGGGATCTTGAGAAGGA

CATGAAAATGACCCCAAAGAGTAGAGTGCCCAAGTGAACTGGGTCAATATTACCAATTTAAAAAACCAAAGTTCTGAGCTCTTGTTTTCCTGCATCTCCC

ATATCCACAGTTGCTTTTGAGAAGCTATGTTTCATCCTAAGAATTGCATCAGACTCAGGGTAAATATTTTGCCTGGGAAATTTGGCTGGTTGTGAATGGG

GAAGATATTTATATCCTACATTCCAGCACCTTCCCAAAGAACAGATTAGACACCCCAGTGTACTTCCTTCATCCGGTGGGTTCCCTGCTGGTACCACTCT

CCAGAATCCATACATGGTGTGTTGATTTTCCAGAGAGAACAATTAAGTGAAGTTTGTTGAGGGGTAGGGGGCAGGATGGATGGCTCTCAAACGTGTAGCG

GTACTTTTAGTTTCCTCCCGGGGTCCCATGGGACTTAAATATGTTCTGATGCTTGTGTAGATTCTCTTATTGCTGTGTTCATGGTTGGCCCTCTCCCCCT

CCCCTCTGCACGCCTTTATCCTTAAAAATTACCATTTGGGGGGGGTGCAGTAAATTGCCTCTTCATCCTCCCAAGGCAACAAAGAGGAGGCATCAGGGAA

AAATGGGTGAGACTTAGTCCAGACCCCGGCTTTGCCCTCAGCCAGTTTGTTTATGTTGGAAAGCACTGGTGACTGGTGGGACTAGATGAACTCACAGTTA

GATTTCAGGGAAACAAAATTTAACCTTAACCAAGTCTGAAGGGCTGACACAGAGAAACACCCGGTCTGTGACTTGTCCCCAAGGGGTTGGTTGTCTCAGT

CCTTATCACTGTGGAATTACAAAGATAAATATTACCACCCTCCTGGTTCTTACCTGTCATCCTAGAGTAGACCTAGAAAAGACAGCCAAGTTCCTTGTGA

CCTCAGCCTGAGCAATCAAACCTCGAAGACTGATGATAGCTAACGTCGATTTCTTGATAGCTCTCGTACCACCGGAGCAACCACAGGATTGTGTGCTAAG

CCATATTTTGTAAAGTTATCTTTAGTCGATCAGCAATATGTTTTCCTGTAAATTTGGAATGTTTTCTCATCCTGACTTGTTGTCGGAACTCTACTGAAAA

ACAACCTGATCAATATAAAAGCGTTCAAGCTATGCAACACTG
Translation
 - UNI18585 - - UNI29636 - MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVN - UNI18585 - - UNI29636 - 

KQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSP - UNI26593 - RWLEASKPLRKQLKG GGFPCTLHFRVRYFIPDPNTLQQEQTR RHLYFL

QLKMDVCEGR RLTCPLNSAVVLASYAVQS - UNI700 - SHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHS - UNI3610 - SGLK

QSEAESCYINIARTLDFYGVELHGGR - UNI4534 - DLHNLDLMIGIASAGIAVYRKYICTSFYPW WVNILKISFKRKKFFIHQRQKQ - UNI44

72 - AESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKK KSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLP

SRSPPITPNW WRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRE ESLSENNPAQSCLTQKSSSSVSPSSNAP

GSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDK SDDGDGYLVLIRITPDEEGRFGFNLK - UNI3765 - GGVDQKMPLVVSRINPESP ADTCM

PKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKA AVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLI

QFE - UNI4750 - QLYRKKPGLAVSFAKLPQNLDKNRYKDVLPY YDTTRVLLQGNEDYINASYVN MEMPAANLVNKYIATQGPLPNTCAQFWQVV

WDQKLSLVVMLTTLTERGR TKCHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTE - UNI2339 - TGEEHTVTHLQYVAWPDHGVPDDS

SDFLEFVKYVRSLRVDGEPALVHCS SAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTS SQYKFVCEAILRVYEEGLVQRLDPS
Transcript ENSMUST00000043585
Sequence
AGCGAGCTTCAGTGCCGCCCGCCCGCGCGACCTACCTGGGCGCCCCGCGCCCCCGGATGCTGCAG - UNI18585 - - UNI29636 - GTTACTCG

GCGGCCGTTATGACCTCCCGGTTACGTGCGTTGGGTGGAAGAATTAACAATACCCGAACCTCTGAATTGCCCAAAGAGAAAACTCGATCCGAGGTCATCT

GCAGCATACGGTTTTTAGATGGCTTGGTACAGACCTTTAAAGTTAAC - UNI18585 - - UNI29636 - AAACAAGATTTGGGCCAGTCGCTTCT

GGATATGGCCTATGGCCACCTGGGTGTGACGGAGAAGGAATACTTCGGCTTGCAACATGGCGACGACCCAGTGGACTCTCCT - UNI26593 - AGAT

GGCTTGAGGCAAGCAAACCCCTCAGGAAGCAGCTGAAAG GAGGTTTTCCCTGTACCCTGCATTTTCGAGTAAGATATTTTATACCTGATCCCAACACAC

TGCAGCAGGAGCAAACCAG GCATCTATATTTCTTACAACTGAAGATGGATGTTTGCGAAGGAAG GTTAACCTGCCCTCTCAACTCAGCGGTGGTTCTA

GCCTCGTACGCAGTACAAT - UNI700 - CTCATTTTGGAGACTTTAATTCTTCAATACATCATCCAGGCTATCTTGCCGACAGCCAGTTCATACCAG

ATCAAAATGATGACTTTTTAAGCAAGGTGGAGTCACTCCATGAACAGCACAG - UNI3610 - TGGGCTAAAGCAGTCGGAAGCCGAATCTTGCTACA

TCAACATAGCTCGAACCCTTGACTTCTACGGAGTGGAGCTTCATGGAGGCAGA - UNI4534 - GATCTGCACAACCTAGATCTAATGATCGGGATTG

CGTCTGCAGGCATTGCAGTCTACCGAAAATACATTTGCACAAGTTTCTACCCTTG GGTGAACATACTCAAAATTTCTTTCAAAAGGAAAAAGTTCTTCA

TACACCAGCGGCAAAAACAG - UNI4472 - GCTGAATCCAGGGAACATATCGTGGCCTTCAACATGCTGAATTACCGATCTTGCAAAAACTTGTGGA

AATCCTGCGTCGAACACCATTCGTTCTTTCAGGCAAAAAAGTTACTACCTCAGGAAAAGAATGTTCTCTCTCAGTACTGGACTCTAGGCTCCAGGAACCC

CAAAAA GTCTGTAAATAACCAATATTGCAAAAAGGTGATTGGAGGGATGGTGTGGAACCCAGTCATGAGGAGGTCCTTATCAGTGGAACGGCTGGAAAC

CAAGAGCCTGCCTTCCCGGTCCCCTCCCATCACCCCCAACTG GCGAAGTCCTCGGCTCCGGCATGAAATCCGCAAGCCCCGCCATTCCTCCGCGGACAA

CCTGGCCAATGAGATGACCTACATCACAGAAACCGAGGATGTGTTCTATACCTACAAGGGACCCCTGTCCCCCAAAGACAGCGACTCTGAAGTCTCCCAG

AACCACAGCCCACACCGGGA GAGTTTGTCCGAAAACAACCCAGCCCAAAGCTGCCTGACCCAGAAGTCATCCAGTTCTGTGTCTCCATCTTCGAATGCT

CCAGGCTCCTGCTCTCCAGATGGAGTTGACCAGCGGTTCTTAGAAGACTACCACAAGGTGACCAAAGGGGGGTTCGTCGAGGACGCCAGCCAGTACTACT

GTGATAAG AGTGACGATGGAGATGGCTACCTAGTCCTGATCCGGATCACACCAGATGAAGAGGGAAGATTTGGCTTTAACCTTAAG - UNI3765 - 

GGAGGAGTGGATCAAAAGATGCCGCTCGTGGTCTCGAGGATAAACCCAGAGTCACCT GCAGATACCTGCATGCCTAAGCTGAATGAGGGGGATCAGATC

GTGTTGATCAATGGCCGGGACATCTCAGAGCACACTCATGACCAGGTGGTGATGTTCATCAAAGCAAGCCGGGAGTCCCACTCGAGAGAACTGGCCCTGG

TGATCAGGAGAAAAG CTGTGCGCTCGCTGGCGGAGATCAGATCAGAAGATGAGCTGAGTCAGCTTTTCCCAGAAGCCATGTTTCCTGCATGTCCTGAGG

GTGGGGACAGTCTGGAGGGATCCATGGAGCTGCTGAAGAAAGGTCTGGAAAGCGGTACAGTGTTGATCCAGTTTGAG - UNI4750 - CAACTCTACA

GAAAGAAGCCCGGCTTAGCCGTCTCATTTGCAAAGCTGCCTCAGAATTTGGATAAAAACCGATACAAAGATGTGTTGCCTT ATGATACCACGCGGGTAT

TATTGCAGGGAAATGAAGATTACATTAATGCCAGTTATGTGAAC ATGGAGATGCCCGCTGCTAACCTTGTGAACAAGTACATTGCCACTCAGGGACCGC

TGCCAAACACCTGTGCACAGTTTTGGCAAGTTGTCTGGGATCAGAAGTTGTCTCTTGTTGTCATGCTGACGACTCTCACCGAGCGAGGGCGG ACCAAAT

GTCACCAGTACTGGCCGGATCCCCCTGACATCATGGACCATGGCATCTTTCACATCCAGTGTCAGACAGAGGACTGTACCATTGCTTACGTGTCCCGAGA

AATGCTAGTTACAAACACGGAG - UNI2339 - ACCGGGGAAGAACACACAGTGACCCATCTCCAGTATGTGGCGTGGCCTGACCACGGCGTACCTGA

TGACTCATCAGACTTCCTGGAGTTTGTGAAGTATGTGAGGTCCCTGAGGGTCGACGGTGAGCCTGCCCTCGTTCACTGCAG TGCTGGAATAGGTCGGAC

AGGTGTTTTAGTCACTATGGAAACAGCCATGTGCTTAATTGAGAGGAACCTGCCTGTTTACCCACTGGATATTGTCCGGAAAATGAGAGACCAGCGCGCG

ATGATGGTGCAGACGTCA AGCCAATACAAGTTTGTGTGTGAAGCGATCCTTCGAGTGTACGAAGAAGGCTTAGTCCAGAGGCTGGATCCCAGTTAG
Translation
 - UNI18585 - - UNI29636 - MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVN - UNI18585 - - UNI29636 - 

KQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSP - UNI26593 - RWLEASKPLRKQLKG GGFPCTLHFRVRYFIPDPNTLQQEQTR RHLYFL

QLKMDVCEGR RLTCPLNSAVVLASYAVQS - UNI700 - SHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHS - UNI3610 - SGLK

QSEAESCYINIARTLDFYGVELHGGR - UNI4534 - DLHNLDLMIGIASAGIAVYRKYICTSFYPW WVNILKISFKRKKFFIHQRQKQ - UNI44

72 - AESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKK KSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLP

SRSPPITPNW WRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRE ESLSENNPAQSCLTQKSSSSVSPSSNAP

GSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDK SDDGDGYLVLIRITPDEEGRFGFNLK - UNI3765 - GGVDQKMPLVVSRINPESP ADTCM

PKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKA AVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLI

QFE - UNI4750 - QLYRKKPGLAVSFAKLPQNLDKNRYKDVLPY YDTTRVLLQGNEDYINASYVN MEMPAANLVNKYIATQGPLPNTCAQFWQVV

WDQKLSLVVMLTTLTERGR TKCHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTE - UNI2339 - TGEEHTVTHLQYVAWPDHGVPDDS

SDFLEFVKYVRSLRVDGEPALVHCS SAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTS SQYKFVCEAILRVYEEGLVQRLDPS

For any suggestions or comments, please send an email to unitrap@crg.es