Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038766 (Gabpb2)
Chromosomal location
Chr 3: 94985688 - 95021825 (-)
Description
GA repeat binding protein, beta 2 Gene [Source:MGI (curated);Acc:Gabpb2-004]
RefSeq_dna
NM_172512 NM_029885 
RefSeq_peptide
NP_766100.1 NP_084161.1 
UniGene
Mm.224820 
MGI
MGI:95612 
Uniprot/SWISSPROT
P81069 
Uniprot/SPTREMBL
Q8C2T8 Q3TQS9 Q8C359 
Human Ortholog
ENSG00000143458 (GABPB2)
Omim not available
UniTrap UNI1933
Vector Insertion
Chr 3: 95021510 - 95021677
Public Clones CE0173 (sanger) RRJ488 (baygenomics) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21607
Vector Insertion
Chr 3: 95020191 - 95021510
Public Clones (sanger) 5SD032C06 (ggtc) 5SD059B05 (ggtc)
Private Clones OST324174 (lexicon) OST324146 (lexicon) OST260620 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14182
Vector Insertion
Chr 3: 95010384 - 95010525
Public Clones CMHD-GT_45D6-3 (cmhd)
Private Clones OST345408 (lexicon) OST190888 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26100
Vector Insertion
Chr 3: 95008562 - 95008731
Public Clones not available
Private Clones OST137913 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23830
Vector Insertion
Chr 3: 95007652 - 95007848
Public Clones not available
Private Clones OST243238 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI592
Vector Insertion
Chr 3: 95004038 - 95004039
Public Clones AZ0407 (sanger) CSG336 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107204
Sequence
TTTTATTGCCTCCATTTCTCCGTGAGGGGGGGTAAGGGCCCCCCCAAATATGCATATGTGAAAAGGCCGAAAAGTGAGGCCGCTGGCAAGGAGTCTTAAC

TAGAGAAAGAAACGGGACCAAACTGGCGGGCCCAGTGAGAGCGAAGCCGGCAGCGCTCCGGAATAG - UNI1933 - - UNI21607 - AGTTGAAG

GAGAGAACCAACTCCTGCGAGTTGTCCTGTGGCTTCCACATGCTATG TTTTGTTCTTGGCTGTACTGGGACTTGAACCTAGAGCCTTGCACATATAAAA

AGTGTTCTACCACTGAGCTGTTTTTTCCCTACTCTTTAGCTTGAG - UNI14182 - CTACCTGGGAACTGCTGTTTCTATGCATTAAGATGTCTCTG

GTGGACTTGGGGAAGAGGCTGCTAGAAGCTGCAAGGAAAGGCCAAGACGATGAAGTGAGGACACTGATGGCAAATGGGGCTCCATTCACCACAGACTGG 

- UNI14182 - - UNI26100 - CTCGGAACATCACCGCTTCACCTTGCAGCCCAGTATGGTCATTATTCCACAGCAGAAGTGCTCCTTCGAGCTGG

CGTTAGCAGGGATGCCCGGACCAAAGTGGACAGGACCCCTTTGCATATGGCTGCAGCTGATGGACATGTTCACATCGTGGAACTGCTTGTTAGG - UNI

23830 - - UNI26100 - AGTGGTGCAGATGTGAACGCAAAGGACATGCTGCAGATGACAGCTCTGCACTGGGCCACAGAGCACCATCACCGGGATG

TCGTCGAGTTACTTATCAAATATGGAGCTGATGTCTACGCTTTTAGCAAATTTGATAAGTCTGCCTTTGACATAGCAATGGAGAAAAACAATACTGAGAT

TTTGGTCATGCTTCAGGTGTGTTTCTTTATATCCCCCAAAGTACACTAATTTAGAGATTATTTTGAGGGAGCTGAAGTAAATTAGAATTTCCTCCCATTT

TATCAAATTACAGCATGTCTTGATCATGTCATTCTATATTGGTACCTCTCTTTCATTATTTTTTTTTCAGTTGAGACAGTATCTAAAGTAGCCCAGGGCA

ATCTCAGATTTTGAATGTAATTAAAGATGACTCGTAATCTTCCTGCCTCACATATGCTGGAATTACAGATAGGTACTACCATGCCTGGCCTATGTTTTGA

GATAGAGTCTTACTATAAAGCCAAAGCTAAAGCTAGCCTCTCAAGTAGTCTTTGCAAAGCTAAAGACTACAGATCTTTTCTGGTTCTGAGAGCTGCCCAG

CTTTCAGGCAGCTCCACAATCCAGACATCTTCCTTTCTTCGTCCTGCTGCTCAAAGTCTCCTCCCCCACAACTCTTTGCTCCCTTTACTGTTAGTGGGGC

TTTCAAGAATCTTCCCGGCGTCTGTTCCTCTCGGATATACGGGCTTTTGCTTATCTCCTGTTTGCACCAAAGGCTGCTCAGCCGCCTTCCTTTCTGGAGC

AGACTTCTGATTTAGAGAGAGGGAATGTTACAATTTGGAGGAACATGCCTTAGAATTCATGCACATGTGTGCCCTGGATCACTAGTGCACAACACACATA

ACAAATAAATTATAATTAAAAATACTTTAAACCA
Translation
 - UNI1933 - - UNI21607 -   - UNI14182 - MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDW - UNI14182 - - UNI2610

0 - LGTSPLHLAAQYGHYSTAEVLLRAGVSRDARTKVDRTPLHMAAADGHVHIVELLVR - UNI23830 - - UNI26100 - SGADVNAKDMLQM

TALHWATEHHHRDVVELLIKYGADVYAFSKFDKSAFDIAMEKNNTEILVMLQVCFFISPKVH
Transcript ENSMUST00000107209
Sequence
AAATATGCATATGTGAAAAGGCCGAAAAGTGAGGCCGCTGGCAAGGAGTCTTAACTAGAGAAAGAAACGGGACCAAACTGGCGGGCCCAGTGAGAGCGAA

GCCGGCAGCGCTCCGGAATAG - UNI1933 - - UNI21607 - AGTTGAAGGAGAGAACCAACTCCTGCGAGTTGTCCTGTGGCTTCCACATGCTA

TG - UNI14182 - CTACCTGGGAACTGCTGTTTCTATGCATTAAGATGTCTCTGGTGGACTTGGGGAAGAGGCTGCTAGAAGCTGCAAGGAAAGGCC

AAGACGATGAAGTGAGGACACTGATGGCAAATGGGGCTCCATTCACCACAGACTGG - UNI14182 - - UNI26100 - CTCGGAACATCACCGCT

TCACCTTGCAGCCCAGTATGGTCATTATTCCACAGCAGAAGTGCTCCTTCGAGCTGGCGTTAGCAGGGATGCCCGGACCAAAGTGGACAGGACCCCTTTG

CATATGGCTGCAGCTGATGGACATGTTCACATCGTGGAACTGCTTGTTAGG - UNI23830 - - UNI26100 - AGTGGTGCAGATGTGAACGCAA

AGGACATGCTGCAGATGACAGCTCTGCACTGGGCCACAGAGCACCATCACCGGGATGTCGTCGAGTTACTTATCAAATATGGAGCTGATGTCTACGCTTT

TAGCAAATTTGATAAGTCTGCCTTTGACATAGCAATGGAGAAAAACAATACTGAGATTTTGGTCATGCTTCAG - UNI23830 - GAAGCAATGCAGA

ATCAGGTGAACACTAACCACGAGAGAGCCAACCCAGTGGCTAACCCTGTGACTGTGACTGCTCCGTTCATCTTCACCTCTGGAGAGGTCATTAACCTCGC

TAGCTTTGTCTCTTCAGCCAACACCAAAGCAACCTCAG - UNI592 - CTCATTTAGAAGAAATGGAAGAAGGAAATTCTCTTGACTCCTCGACCCAG

CAAGTGGTGGGGAGTGGAGGCCAGAGGGTCATCACCATCGTGACTGATGGAGTCCCTCTGGGTAACATCCAAACATCACTCCCTGCTGGAGGCATTGGCC

AGCCATTTATTGTAACTATGCAAGATGGACAGCAAG TTCTAACTGTGCCTGCTGGTCAGGTTGCAGAGGAGACAATAATTGAAGATGAAGAAGAGGAAG

AAGAGAAATTGCCATTGGTGAAGAGACCAAGGATGGCAGAGATGACAAACAGGGTTGAGGAAATGAAG GAAGGCAGTGAAAGAGAGCTACTGCAGCAAC

AGCTCCAGGAGGCCAACCGAAGAGCCCAGGAGTACAGACACCAGCTCCTCAAGAAAGAGCAGGAGGCCGAGCAGTATCGGCTCAGGCTGGAGGCTATGGC

TCAGCAGCAGACCAACGGAGTTGAAGTTGATGTCACCGTAGTTGAGGAAGTAGCTGAAGTGGATGCTGTAGTGGTGACAGAAGGGGACGAGGTAGAAAGA

GCAACACAAGTCATGAAGTCAGGAAGGACCACGGAGCCTCACACTAACGTTTCCATAGAAACTATTTCATCCTAACACCAACGGCTACAACTTGTGCTCA

CTCATCATATTCTTTGTAAGAAGAAAGTATAGACTGCAGGTACTGCATACAAATTAGAATGTCCTTAAGAGGGTAACAATAGCCGGGCTCAAGGCCTGAG

CCTAGGAAGGCTGTGTGTGCAGCTGGAAAACTCAGAGCCACTTTAGGGGCATCTGAGGGACCAAAGGACCAGGACCAAATCTCTCAGCTCATATCGTTGC

TTTAAACAGAGTACTGGGCATTGTAGGTTGAATTTCTTTTTTAATAGTTAGCTTTATATCGAAAGATTTTAAGATAGTACTTGTAATACATATACACCAA

GAGCCTTTAATAGTTACACCTGAAATTTTTCAAGTGGCCTGAAAATATGCCTTAGATTTATGAGATTGATGCAGTTGTAGGAAGCCTCCTCTTGAGGAAA

AGTAAAGGATAGCATACAGTTGTAAAGAGCAGGCACACAAGTTCTCCCTAGTTAACCTACTGAAAAGAAGTCCCTAAGCCAGGCGTGGTAGTACACACCT

GTGATGTCAGCACTCAGGAAGCTGCAACAGGAAGTTATTTGAGGTCAGCCTGAGCTAAAGAGAGTCCTTCAATAAAAGAGGGCCAGATGTGGTGACACAT

GCCTTGAGTTCCAGCACTCGGGAAGTAGACACAGGCAGATCTCTGTTGAGTTCAAGGCCATGTGGTCTACGTACCAAGTTCCAGGCCAGGCAAGGCTACA

CAGTGGGACCCTGTCTTCACATATAGCAGAGCACAGCTGGGGTGGAGAAGTGGTGCTTGCTCTTCCAGAGAACCTGGGTTCCATTCCTAGCACCCGAGTC

AAGCTGCTCACAATTACATGTCCATCCAGCTCCCAGGGATCATGCCCTTTTCTGGCATGTGTGTATATCCACACACATACATTTATATATACATATCAAT

GAAAGAGTTTTAAATTAATAACAAAAAAATTAAACTAGTTGAATGCAGTGGTTCACACTTTGGGAACCTGAAACAGAAAGATTACGAGTTTAAAGCCAGC

TTGAACTCCATTGTGAGTTACAGGTCAGCCTAGGCTACAGTGTGGGATCTTAGTGCAAGAGAAAAATCAAGTGTCATGGTGTGCACCTCTAATTGTAGCA

CTCAGGAGGTAGAGGCAGGAGGATCTCTAAGTTTGAGGCCAGCCTAGTCTACAAAGAGTTCTGGTATAGCCAGGGCTATACAGAGACACTGCCTCAAAAA

TAGAGAAAAATTAGCAAAGAAGGGCTGACTTAGGAATACCTGATAAATTGTGTCCATTGCTTAGATACAGTATAAAAAAAAAAATAGGCATAGTGGCACA

GCCTATAATCCCAGCACTTGGGAGGTGAGACGGAAGACCACTGTAAGTTAAAGATCAGCTTTGGCTTCAGTGAGATCTTTCTCAAAATAACAGCAAAAAC

CCGGAAATGACCAGATGGAGCAGTGACGGGCTCTCATCCCTGCACTTGGGGAGCAGAGGCAAGCAGGTCCTTGGGATTCTAACTAGCCTGGCCCACAGGG

TCAGTTCCAGCCTAGCAGGATTACTCAGACCCTAACAAGGACTCCCTGAGGACATAGTTCAGTGGTAGAACGTGGTGCTTAGCTTGCAAGGAAGCCCTGG

GTTCGTCCTTTGACACTGTATGTACACAGCGAGAGGAGGGCAGAAGTGCAGGGAAGAAAACCGTTGACAGCAGACTTAAACTCAGGAGAGAAGCTGTGCT

GCTGATGGGTAGAAGCTATGTGCAGAGCAGCACCCTCCAGGCTGTGCTTCCAGAGAGAGGCTTCTGGGCTCTGAGTCTCTGGTCTTGAGATGGAAACTAT

ATATTGGCTGGACTTTATAAACCTGCAAGCAGGAGGATCACTTTCAAAAGTTTTTAAATTAATTTTTATTTGTCATTGTAACAACATCTTTCATCCAAAC

ATCTATTTATATAAAGTCAAGCCTAAAACTCTTTAAATTATATAAAATTTGGCCAAATTTTCTGTGTCATGTGGGACACTGGTGCTTTCTGTAGCACTGA

GCACTCTGTCAAACACAAAGCAGTGTGGCAGACTGACCAGGCTGGGGAGGTTTGCCCCTGTTGATTTAGTGTGAGTGCATTGCTGCTTCTGTTAGTGTGG

CCATGGAGTCTGTGCCCTGTAGTGCTCAGGTGACAAAGGGAGCAGGTATCACTGCCACAGCAAGGAGCCACCCCAGGCCCATTGCTGACCTCCCCTCTCC

CTTACTCCACATTCCCCTTGCTCAGACACTTGAAACATTTTCAGTGCTAGGCTTTTGAGGAAGGGTTGGGGCAGGTCTCTCTAGCATGAAGTGTGTGTTT

GTGTTTGTATAGCTGGGCACGGTACTCATGCCTGTTAGCAGTCAAGAGCTATAGGAGGAGGGTTGACATGAGTGCAAGGCCAGCCTGAACTACATTGTGT

GAACCTGTCTCAAAAACCACAAAAATTAGACACCTGAGCATTGTGCCTCGTGCCTGTAATCCCCACTCAGAGGATCACTGGGGGTCTCAGATGAGACTTC

TAGGCAATACAGTGAGATGTACTCTAGGGCAACATGGACCACAGAGACTATATAGTCCAGGATGTCTTGTACTGTAGTCCCTTGTATGTCTTTTTATGAG

GTCCTGGGTTCAATCCCCAGGACTGCAAAAAACAATATTTAAACGTCTTATAGACAGGATGTGATAGTACATGTCTACAGTCCCAGAACTGGGCGAGGGA

GGCAAGAGGTCAGACGGCGAGAGTCATCCTTGGCAATTTCTCAAGTTTGAGGCCTGCTTACACCAAAGTGGGAGAGGAATAAGCACTCAGAGAGGGATTG

GGGTAGGTGATGGGTAACGTAGAATTGCTTGCCTTATTGTACAGGTGCCAAGTACACTTTTGAATAACTGTTGAGAATAGGTTTCCTGATTAGTGATCAT

GAAGAAAACATGCATTTTTAACCTGGAAAGAGCTTGGCAGTTAACATGGTTCTGGTTACCTTGATTAGTGGGATAATTTGTTGCAGTGTTTCAGAGGTAT

AGAATCATTTTTGGCTCAAAATAGACTGAAAACATAATTCTCCAAATCACATTTAACAAAATTGAATATTAGAGGTTTATAGGCAAAAATAACCATTTTG

AAGTTAACCTTGACTGCTAGCACTGTCTGCTCCAGGGATCTGAGCATCAGGGATGATCTAGTGTGTAGAGAGTGTTGTGGGAGCACAGGGAGGAGGCGTG

TGAGGTTGAGGATCCGTCTGCTGTGGATTCTTCTGTTTGCAGCGCTCTTCTGAGACACCCAGGAAATGGGGTGCTAGCAGTAAGCTATTGTGAGTGGCAT

TTCAGAGCCTTGGTAACTAGAGGGAGCAGGTTTCTTTGTAGGTGGCTTTTGTTTACATCCTTAGAGCACATGTTGAGTTTAATTTCCTTCCTTCTTTTAA

AGGAATAGATGCTAACTGCAGAGGATAACTGTACCTAACCACCTCGTTATCTCAAGTAGTATCTGTGGGGATGGGATCTGTCCATCTAGTCCTCCCTTCT

GAGCAGGGCTTCTTTCCACCTTTAAGGAGGACCAAGTTTCATTGTTCCAAGTCACTTTTGAGCATGAGGTCTCTGAGTTAGAAAAGGAGAGACAGACAGT

GTCTGACAGGAAAGAGGTTCTCTTTTATTTACTTTAATAGATGCCTATCATCTCAAAAAGGAAGTAGGCTTTCCTTTCGATTAGACTGCAGTGAGTGGGA

GAGGGTGATTTCAGTTAGTTAGAGATTATTATTGAATAGTCAAGCACAGGGCAACGTGAGAAATCCCAGCACTTGGGATTCAGAGTTAGAGGCCATCCCG

GGCTACACGAAGGCAGTATCTTAGAAACAAAAGATGCGGCTGGAGAAATGGCTCAATGGATAGGCAAAAAGAGGGTCCAGTGACCCTCCAAGTGGGGATT

ACAGCATGAGGCACAATGATCAGCTGTCTTGTTGCTATATACAAATTTGAAGGTCCAAATTCAGATCTTAGCACCCACTCTAACAAACCATGCATGGTCT

CAGGTGCACCTGTATCCCTAGTCCTCTAGAAGGATGAGGCAGGAGGATCACTGGGGCTTGCTGGCTGCCAGCCTTGCCACAAAGGTGAATTTCAGGTTCA

GGGAGAGACGCTGTCTCAAGTGAACAGGCAGAAAGTAATGGAGGACCCGATGTTCTCTTCTACCCTGAACCTAGACACACATGCATGTACACCACACTCA

CATATAGACAGCACACACAAACGCCCAAATAAGTAGAAATTAAATATTGAATACATTAATATCATTTTATGACTTCACATAACCTTCCAAGTCAGCTTTT

TTTGTTTGTAGCTCTTCTAAAAACTGGGCTCTACTCTGTAGCTCAGACTTGCCTCAGACTCAGGGCAATCTTTCTGCCTTGGCCTCTTGAGTGCTAGGAC

TGTAGGAGTGAACCGCCTCATCTGGCTTGGGTTGGTGGAGAAGATGACTCTTAGATCTTCTGAGTTAAGACATGTTAGCGGATTAGTGGAGCTGGGTTAG

TGGGAATCACGTAGCAGAGGAAGTGTTCAGAGCTGGGCCTCCAGCAGGGAGAAGGCCAGGCTTAGGCCTCTACAGTAAAGCTGCTTTCAGGAATACAGTG

TTAAGTCAGGGCTGTAGATTAATACAGGGAATTATAGACCCTACATTTGCATTTTGGTTATAAGAGAAAGAACTGTAGCTGGGCAGTGTTAGCGCACGCC

TTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCAGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAAGGCTACACAGAG

AAACCCTGTCTCAAAAAAAAAAAAGAGAGAGAGAGAGAGATGTGTTACAATATCTGTTCTTCCTGGCTTTGGGAAATTGTGCCTTCCCTCCATGTTCCTG

CCTCTGGGGGGGTCTCATTATTGCAAGGTCAGAGCAGAGACCACATGGCTGACATAGGAGAAAGCAGCTTTATGGGGTTTTGCTCTGAACTCTGTGCCTT

AAAAGACACCTTTCTGTCAGATGTATATTTACTTTTCTGTTTTGTTTCCAAACAGTCTTACTATGTAGCTCTGGCTGCCTGGAACTTGCTGTGTAGACCA

GGCTGGCTCAAATGTTTAGAGACCCCCCTGCTTCTGCCTCCACCTCCCAAGTGCTGGAATTAAAGGCACCTGGCAACAGACAGTTTTTATATCCCTTTGC

TGCGTGCACATTAGTGTATTTGTATGTAAATAAATACATAATGGATCTTCCTCCGTTTTCTCTTTAAGATTCAGCTCTAAATTATCTGGGATAACCTGGA

AGCTTTATTAAGTTACATAGGGTTTCTTTGAATTCCCTTAATCCAAGTGTGGGGGGCGGGGTATACATGCGTTGCTGTGGGTGGGGGAAGGCTGTAGAGG

GAGCATTAAGGAAGTTGAGGCCCGAGGAGATGGTCCATGTTCGTGGGGAAGCAAGAAAATAAATGCAAAGGCTCCTTGTCAGTGCACAGTGATAGGGACC

AAAGTGAGCCACCATCATGGCTGGCTGCCTTTATACCTGTTGAAGAAAACCCCTCAGAGCCAGGCGTGGGGCACACACCTTTAATATTGCACTCAGGAGG

CAGAGACAGGTGGATCTCTGAGTTCCAGGCAGCCTAGGGCTGTACAGTGAGACCCTGGCTGGGTAGGAAATGAAAAACCCTTTAGCTTCCAGACAGGAAA

GCCCAGATGAGGGGCTGTGGATGGACAGATGGCCTAGGCTCTGCATTCCCAGCTCAGAATCTCATGTTGAGAGAGAACTCATTCTAAGAATGCCAAGGTG

GACATCCCCTAACATCAGCCACTTCCAATGCTGTAAGAACTGAGGCACGTGGTGAACTCTGGTCACTTTCTGTCCTGATGTTTCAGAGAGTAGCTTGCAG

TTCTCTACTTGAGCAGATGAATTTACACCAAGGCTGCCAGCATGCACTTTAAGCTCTTACCTCTATTTTGTTTTTTGTTTTTCTTTGAATTGGGGTCTCA

CTCTAGCCCCGACTAGCCCAGGACTCACAGCAATCCTTATGCCTTCATCTCCCATGTACTAAGATTACAGACTGAGCCACCATGCCAGATCGGCTCTAGC

TCCATTTACCGAAGTGCCTCTACCCTTTTTGGAGTTTGTGCTCCATTTCTTGTGACTATCCTTACCAGGAGACCAAAAGCAAGAAGGATGTGAATTAGAA

TTAAATAGCTTTGAGCCTCTGGTGCTGCCCTTTCAAAGGTTTTAACCTCTCTAGGGTTAGGGGAAGGAAGATAATTCCTAAACTCTACACAAGTAATTAG

GCTTGTTAATAGCAGGAAATTGTGATCCTCTCTGTCTTCCCTGTTTCCAATCCCCTACTGTTTCTGCCATCCCATGGCTCTTGTCTTTGGAAGGCTTTGC

CAGGCACTGGAACATAATTAGTTGGTCATCTCTAGTCTGTGGGACTCACCTTTCCTTTCTCTCTTTTCTCCTTCCCAACCACATATTTTGTTCTGATGTG

ATTTGTTTCTGAGAATTAAGTAGGTTATACTCTATATTTCCACTTAGTTTCTGACATCTTGCTATGTCAACTGTTACAGTAGCAACTCTGCTCCCTGGCC

TTGCTCAATGTGTCCTTCTGCCAAGGCCATGTAGGGGTGGGTAGCCCAGGATTCTTTTCACAGTGTCCTCTTGTTTTTCAAGTTGTCTGGCAGCTTTATG

TACAATAAACGTTCAGGAAAACAAAAGTTTCTTTTTTAGGATAAAATAGTTCAATTCTGATGAGCAAGCTTATATGTACATGTGTGTGGATATGCATTTG

TGTATATATACCTATACAGATCTATATTATATATACAATTTTGTACTATCATTTAAAATAAAGACATTTCTTAATAAAA
Translation
 - UNI1933 - - UNI21607 -  - UNI14182 - MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDW - UNI14182 - - UNI26100

 - LGTSPLHLAAQYGHYSTAEVLLRAGVSRDARTKVDRTPLHMAAADGHVHIVELLVR - UNI23830 - - UNI26100 - SGADVNAKDMLQMT

ALHWATEHHHRDVVELLIKYGADVYAFSKFDKSAFDIAMEKNNTEILVMLQ - UNI23830 - EAMQNQVNTNHERANPVANPVTVTAPFIFTSGEVI

NLASFVSSANTKATSA - UNI592 - AHLEEMEEGNSLDSSTQQVVGSGGQRVITIVTDGVPLGNIQTSLPAGGIGQPFIVTMQDGQQV VLTVPAGQ

VAEETIIEDEEEEEEKLPLVKRPRMAEMTNRVEEMK EGSERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLRLEAMAQQQTNGVEVDVTVVEEVAE

VDAVVVTEGDEVERATQVMKSGRTTEPHTNVSIETISS
Transcript ENSMUST00000090818
Sequence
CCAGCTCACGAGGTCCTCAGTAGGAAGGAGTCGGACTCAGAGGTGCGTTGAGGTCCTGAGAGAAGGGCAAAGTGGCTCCGCTAACCCATTTCCTTCAGAT

TCCTCCGCCAGGACGTATAGTCACAGCGCCTTCACTTCCGGGTCCGCCATTTTATTGCCTCCATTTCTCCGTGAGGGGGGGTAAGGGCCCCCCCAAATAT

GCATATGTGAAAAGGCCGAAAAGTGAGGCCGCTGGCAAGGAGTCTTAACTAGAGAAAGAAACGGGACCAAACTGGCGGGCCCAGTGAGAGCGAAGCCGGC

AGCGCTCCGGAATAG - UNI1933 - - UNI21607 - AGTTGAAGGAGAGAACCAACTCCTGCGAGTTGTCCTGTGGCTTCCACATGCTATG TTT

TGTTCTTGGCTGTACTGGGACTTGAACCTAGAGCCTTGCACATATAAAAAGTGTTCTACCACTGAGCTGTTTTTTCCCTACTCTTTAGCTTGAG - UNI

14182 - CTACCTGGGAACTGCTGTTTCTATGCATTAAGATGTCTCTGGTGGACTTGGGGAAGAGGCTGCTAGAAGCTGCAAGGAAAGGCCAAGACGAT

GAAGTGAGGACACTGATGGCAAATGGGGCTCCATTCACCACAGACTGG - UNI14182 - - UNI26100 - CTCGGAACATCACCGCTTCACCTTG

CAGCCCAGTATGGTCATTATTCCACAGCAGAAGTGCTCCTTCGAGCTGGCGTTAGCAGGGATGCCCGGACCAAAGTGGACAGGACCCCTTTGCATATGGC

TGCAGCTGATGGACATGTTCACATCGTGGAACTGCTTGTTAGG - UNI23830 - - UNI26100 - AGTGGTGCAGATGTGAACGCAAAGGACATG

CTGCAGATGACAGCTCTGCACTGGGCCACAGAGCACCATCACCGGGATGTCGTCGAGTTACTTATCAAATATGGAGCTGATGTCTACGCTTTTAGCAAAT

TTGATAAGTCTGCCTTTGACATAGCAATGGAGAAAAACAATACTGAGATTTTGGTCATGCTTCAG - UNI23830 - GAAGCAATGCAGAATCAGGTG

AACACTAACCACGAGAGAGCCAACCCAGTGGCTAACCCTGTGACTGTGACTGCTCCGTTCATCTTCACCTCTGGAGAGGTCATTAACCTCGCTAGCTTTG

TCTCTTCAGCCAACACCAAAGCAACCTCAGGTAGGGTTCTGATAATGAGGCCT - UNI592 - GTTTTAGGCTTAAAAATGAGCAGAGTCCTAGTTTC

CTAG
Translation
 - UNI1933 - - UNI21607 -   - UNI14182 -  - UNI14182 - - UNI26100 -  - UNI23830 - - UNI26100 - MLQMT

ALHWATEHHHRDVVELLIKYGADVYAFSKFDKSAFDIAMEKNNTEILVMLQ - UNI23830 - EAMQNQVNTNHERANPVANPVTVTAPFIFTSGEVI

NLASFVSSANTKATSGRVLIMRP - UNI592 - VLGLKMSRVLVS
Transcript ENSMUST00000070774
Sequence
CCAGCTCACGAGGTCCTCAGTAGGAAGGAGTCGGACTCAGAGGTGCGTTGAGGTCCTGAGAGAAGGGCAAAGTGGCTCCGCTAACCCATTTCCTTCAGAT

TCCTCCGCCAGGACGTATAGTCACAGCGCCTTCACTTCCGGGTCCGCCATTTTATTGCCTCCATTTCTCCGTGAGGGGGGGTAAGGGCCCCCCCAAATAT

GCATATGTGAAAAGGCCGAAAAGTGAGGCCGCTGGCAAGGAGTCTTAACTAGAGAAAGAAACGGGACCAAACTGGCGGGCCCAGTGAGAGCGAAGCCGGC

AGCGCTCCGGAATAG - UNI1933 - - UNI21607 - AGTTGAAGGAGAGAACCAACTCCTGCGAGTTGTCCTGTGGCTTCCACATGCTATG TTT

TGTTCTTGGCTGTACTGGGACTTGAACCTAGAGCCTTGCACATATAAAAAGTGTTCTACCACTGAGCTGTTTTTTCCCTACTCTTTAGCTTGAG - UNI

14182 - CTACCTGGGAACTGCTGTTTCTATGCATTAAGATGTCTCTGGTGGACTTGGGGAAGAGGCTGCTAGAAGCTGCAAGGAAAGGCCAAGACGAT

GAAGTGAGGACACTGATGGCAAATGGGGCTCCATTCACCACAGACTGG - UNI14182 - - UNI26100 - CTCGGAACATCACCGCTTCACCTTG

CAGCCCAGTATGGTCATTATTCCACAGCAGAAGTGCTCCTTCGAGCTGGCGTTAGCAGGGATGCCCGGACCAAAGTGGACAGGACCCCTTTGCATATGGC

TGCAGCTGATGGACATGTTCACATCGTGGAACTGCTTGTTAGG - UNI23830 - - UNI26100 - AGTGGTGCAGATGTGAACGCAAAGGACATG

CTGCAGATGACAGCTCTGCACTGGGCCACAGAGCACCATCACCGGGATGTCGTCGAGTTACTTATCAAATATGGAGCTGATGTCTACGCTTTTAGCAAAT

TTGATAAGTCTGCCTTTGACATAGCAATGGAGAAAAACAATACTGAGATTTTGGTCATGCTTCAG - UNI23830 - GAAGCAATGCAGAATCAGGTG

AACACTAACCACGAGAGAGCCAACCCAGTGGCTAACCCTGTGACTGTGACTGCTCCGTTCATCTTCACCTCTGGAGAGGTCATTAACCTCGCTAGCTTTG

TCTCTTCAGCCAACACCAAAGCAACCTCAG - UNI592 - CTCATTTAGAAGAAATGGAAGAAGGAAATTCTCTTGACTCCTCGACCCAGCAAGTGGT

GGGGAGTGGAGGCCAGAGGGTCATCACCATCGTGACTGATGGAGTCCCTCTGGGTAACATCCAAACATCACTCCCTGCTGGAGGCATTGGCCAGCCATTT

ATTGTAACTATGCAAGATGGACAGCAAG TTCTAACTGTGCCTGCTGGTCAGGTTGCAGAGGAGACAATAATTGAAGATGAAGAAGAGGAAGAAGAGAAA

TTGCCATTGGTGAAGAGACCAAGGATGGCAGAGATGACAAACAGGGTTGAGGAAATGAAG GAAGGCAGTGAAAGAGAGCTACTGCAGCAACAGCTCCAG

GAGGCCAACCGAAGAGCCCAGGAGTACAGACACCAGCTCCTCAAGAAAGAGCAGGAGGCCGAGCAGTATCGGCTCAGGCTGGAGGCTATGGCTCAGCAGC

AGACCAACGGAGTTGAAGTTGATGTCACCGTAGTTGAGGAAGTAGCTGAAGTGGATGCTGTAGTGGTGACAGAAGGGGACGAGGTAGAAAGAGCAACACA

AGTCATGAAGTCAGGAAGGACCACGGAGCCTCACACTAACGTTTCCATAGAAACTATTTCATCCTAACACCAACGGCTACAACTTGTGCTCACTCATCAT

ATTCTTTGTAAGAAGAAAGTATAGACTGCAGGTACTGCATACAAATTAGAATGTCCTTAAGAGGGTAACAATAGCCGGGCTCAAGGCCTGAGCCTAGGAA

GGCTGTGTGTGCAGCTGGAAAACTCAGAGCCACTTTAGGGGCATCTGAGGGACCAAAGGACCAGGACCAAATCTCTCAGCTCATATCGTTGCTTTAAACA

GAGTACTGGGCATTGTAGGTTGAATTTCTTTTTTAATAGTTAGCTTTATATCGAAAGATTTTAAGATAGTACTTGTAATACATATACACCAAGAGCCTTT

AATAGTTACACCTGAAATTTTTCAAGTGGCCTGAAAATATGCCTTAGATTTATGAGATTGATGCAGTTGTAGGAAGCCTCCTCTTGAGGAAAAGTAAAGG

ATAGCATACAGTTGTAAAGAGCAGGCACACAAGTTCTCCCTAGTTAACCTACTGAAAAGAAGTCCCTAAGCCAGGCGTGGTAGTACACACCTGTGATGTC

AGCACTCAGGAAGCTGCAACAGGAAGTTATTTGAGGTCAGCCTGAGCTAAAGAGAGTCCTTCAATAAAAGAGGGCCAGATGTGGTGACACATGCCTTGAG

TTCCAGCACTCGGGAAGTAGACACAGGCAGATCTCTGTTGAGTTCAAGGCCATGTGGTCTACGTACCAAGTTCCAGGCCAGGCAAGGCTACACAGTGGGA

CCCTGTCTTCACATATAGCAGAGCACAGCTGGGGTGGAGAAGTGGTGCTTGCTCTTCCAGAGAACCTGGGTTCCATTCCTAGCACCCGAGTCAAGCTGCT

CACAATTACATGTCCATCCAGCTCCCAGGGATCATGCCCTTTTCTGGCATGTGTGTATATCCACACACATACATTTATATATACATATCAATGAAAGAGT

TTTAAATTAATAACAAAAAAATTAAACTAGTTGAATGCAGTGGTTCACACTTTGGGAACCTGAAACAGAAAGATTACGAGTTTAAAGCCAGCTTGAACTC

CATTGTGAGTTACAGGTCAGCCTAGGCTACAGTGTGGGATCTTAGTGCAAGAGAAAAATCAAGTGTCATGGTGTGCACCTCTAATTGTAGCACTCAGGAG

GTAGAGGCAGGAGGATCTCTAAGTTTGAGGCCAGCCTAGTCTACAAAGAGTTCTGGTATAGCCAGGGCTATACAGAGACACTGCCTCAAAAATAGAGAAA

AATTAGCAAAGAAGGGCTGACTTAGGAATACCTGATAAATTGTGTCCATTGCTTAGATACAGTATAAAAAAAAAAATAGGCATAGTGGCACAGCCTATAA

TCCCAGCACTTGGGAGGTGAGACGGAAGACCACTGTAAGTTAAAGATCAGCTTTGGCTTCAGTGAGATCTTTCTCAAAATAACAGC
Translation
 - UNI1933 - - UNI21607 -   - UNI14182 - MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDW - UNI14182 - - UNI2610

0 - LGTSPLHLAAQYGHYSTAEVLLRAGVSRDARTKVDRTPLHMAAADGHVHIVELLVR - UNI23830 - - UNI26100 - SGADVNAKDMLQM

TALHWATEHHHRDVVELLIKYGADVYAFSKFDKSAFDIAMEKNNTEILVMLQ - UNI23830 - EAMQNQVNTNHERANPVANPVTVTAPFIFTSGEV

INLASFVSSANTKATSA - UNI592 - AHLEEMEEGNSLDSSTQQVVGSGGQRVITIVTDGVPLGNIQTSLPAGGIGQPFIVTMQDGQQV VLTVPAG

QVAEETIIEDEEEEEEKLPLVKRPRMAEMTNRVEEMK EGSERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLRLEAMAQQQTNGVEVDVTVVEEVA

EVDAVVVTEGDEVERATQVMKSGRTTEPHTNVSIETISS
Transcript ENSMUST00000098873
Sequence
GTTTTGTTCTTGGCTGTACTGGGACTTGAACCTAGAGCCTTGCACATATAAAAAGTGTTCTACCACTGAGCTGTTTTTTCCCTACTCTTTAGCTTGAG -

 UNI14182 - CTACCTGGGAACTGCTGTTTCTATGCATTAAGATGTCTCTGGTGGACTTGGGGAAGAGGCTGCTAGAAGCTGCAAGGAAAGGCCAAGA

CGATGAAGTGAGGACACTGATGGCAAATGGGGCTCCATTCACCACAGACTGG - UNI14182 - - UNI26100 - CTCGGAACATCACCGCTTCAC

CTTGCAGCCCAGTATGGTCATTATTCCACAGCAGAAGTGCTCCTTCGAGCTGGCGTTAGCAGGGATGCCCGGACCAAAGTGGACAGGACCCCTTTGCATA

TGGCTGCAGCTGATGGACATGTTCACATCGTGGAACTGCTTGTTAGG - UNI23830 - - UNI26100 - AGTGGTGCAGATGTGAACGCAAAGGA

CATGCTGCAGATGACAGCTCTGCACTGGGCCACAGAGCACCATCACCGGGATGTCGTCGAGTTACTTATCAAATATGGAGCTGATGTCTACGCTTTTAGC

AAATTTGATAAGTCTGCCTTTGACATAGCAATGGAGAAAAACAATACTGAGATTTTGGTCATGCTTCAG - UNI23830 - GAAGCAATGCAGAATCA

GGTGAACACTAACCACGAGAGAGCCAACCCAGTGGCTAACCCTGTGACTGTGACTGCTCCGTTCATCTTCACCTCTGGAGAGGTCATTAACCTCGCTAGC

TTTGTCTCTTCAGCCAACACCAAAGCAACCTCAG - UNI592 - CTCATTTAGAAGAAATGGAAGAAGGAAATTCTCTTGACTCCTCGACCCAGCAAG

TGGTGGGGAGTGGAGGCCAGAGGGTCATCACCATCGTGACTGATGGAGTCCCTCTGGGTAACATCCAAACATCACTCCCTGCTGGAGGCATTGGCCAGCC

ATTTATTGTAACTATGCAAGATGGACAGCAAG TTCTAACTGTGCCTGCTGGTCAGGTTGCAGAGGAGACAATAATTGAAGATGAAGAAGAGGAAGAAGA

GAAATTGCCATTGGTGAAGAGACCAAGGATGGCAGAGATGACAAACAGGGTTGAGGAAATGAAG GAAGGCAGTGAAAGAGAGCTACTGCAGCAACAGCT

CCAGGAGGCCAACCGAAGAGCCCAGGAGTACAGACACCAGCTCCTCAAGAAAGAGCAGGAGGCCGAGCAGTATCGGCTCAGGCTGGAGGCTATGGCTCAG

CAGCAGACCAACGGAGTTGAAGTTGATGTCACCGTAGTTGAGGAAGTAGCTGAAGTGGATGCTGTAGTGGTGACAGAAGGGGACGAGGTAGAAAGAGCAA

CACAAGTCATGAAGTCAGGAAGGACCACGGAGCCTCACACTAACGTTTCCATAGAAACTATTTCATCCTAACACCAACGGCTACAACTTGTGCTCACTCA

TCATATTCTTTGTAAGAAGAAAGTATAGACTGCAGGTACTGCATACAAATTAGAATGTCCTTAAGAGGGTAACAATAGCCGGGCTCAAGGCCTGAGCCTA

GGAAGGCTGTGTGTGCAGCTGGAAAACTCAGAGCCACTTTAGGGGCATCTGAGGGACCAAAGGACCAGGACCAAATCTCTCAGCTCATATCGTTGCTTTA

AACAGAGTACTGGGCATTGTAGGTTGAATTTCTTTTTTAATAGTTAGCTTTATATCGAAAGATTTTAAGATAGTACTTGTAATACATATACACCAAGAGC

CTTTAATAGTTACACCTGAAATTTTTCAAGTGGCCTGAAAATATGCCTTAGATTTATGAGATTGATGCAGTTGTAGGAAGCCTCCTCTTGAGGAAAAGTA

AAGGATAGCATACAGTTGTAAAGAGCAGGCACACAAGTTCTCCCTAGTTAACCTACTGAAAAGAAGTCCCTAAGCCAGGCGTGGTAGTACACACCTGTGA

TGTCAGCACTCAGGAAGCTGCAACAGGAAGTTATTTGAGGTCAGCCTGAGCTAAAGAGAGTCCTTCAATAAAAGAGGGCCAGATGTGGTGACACATGCCT

TGAGTTCCAGCACTCGGGAAGTAGACACAGGCAGATCTCTGTTGAGTTCAAGGCCATGTGGTCTACGTACCAAGTTCCAGGCCAGGCAAGGCTACACAGT

GGGACCCTGTCTTCACATATAGCAGAGCACAGCTGGGGTGGAGAAGTGGTGCTTGCTCTTCCAGAGAACCTGGGTTCCATTCCTAGCACCCGAGTCAAGC

TGCTCACAATTACATGTCCATCCAGCTCCCAGGGATCATGCCCTTTTCTGGCATGTGTGTATATCCACACACATACATTTATATATACATATCAATGAAA

GAGTTTTAAATTAATAACAAAAAAATTAAACTAGTTGAATGCAGTGGTTCACACTTTGGGAACCTGAAACAGAAAGATTACGAGTTTAAAGCCAGCTTGA

ACTCCATTGTGAGTTACAGGTCAGCCTAGGCTACAGTGTGGGATCTTAGTGCAAGAGAAAAATCAAGTGTCATGGTGTGCACCTCTAATTGTAGCACTCA

GGAGGTAGAGGCAGGAGGATCTCTAAGTTTGAGGCCAGCCTAGTCTACAAAGAGTTCTGGTATAGCCAGGGCTATACAGAGACACTGCCTCAAAAATAGA

GAAAAATTAGCAAAGAAGGGCTGACTTAGGAATACCTGATAAATTGTGTCCATTGCTTAGATACAGTATAAAAAAAAAAATAGGCATAGTGGCACAGCCT

ATAATCCCAGCACTTGGGAGGTGAGACGGAAGACCACTGTAAGTTAAAGATCAGCTTTGGCTTCAGTGAGATCTTTCTCAAAATAACAGCAAAAACCCGG

AAATGACCAGATGGAGCAGTGACGGGCTCTCATCCCTGCACTTGGGGAGCAGAGGCAAGCAGGTCCTTGGGATTCTAACTAGCCTGGCCCACAGGGTCAG

TTCCAGCCTAGCAGGATTACTCAGACCCTAACAAGGACTCCCTGAGGACATAGTTCAGTGGTAGAACGTGGTGCTTAGCTTGCAAGGAAGCCCTGGGTTC

GTCCTTTGACACTGTATGTACACAGCGAGAGGAGGGCAGAAGTGCAGGGAAGAAAACCGTTGACAGCAGACTTAAACTCAGGAGAGAAGCTGTGCTGCTG

ATGGGTAGAAGCTATGTGCAGAGCAGCACCCTCCAGGCTGTGCTTCCAGAGAGAGGCTTCTGGGCTCTGAGTCTCTGGTCTTGAGATGGAAACTATATAT

TGGCTGGACTTTATAAACCTGCAAGCAGGAGGATCACTTTCAAAAGTTTTTAAATTAATTTTTATTTGTCATTGTAACAACATCTTTCATCCAAACATCT

ATTTATATAAAGTCAAGCCTAAAACTCTTTAAATTATATAAAATTTGGCCAAATTTTCTGTGTCATGTGGGACACTGGTGCTTTCTGTAGCACTGAGCAC

TCTGTCAAACACAAAGCAGTGTGGCAGACTGACCAGGCTGGGGAGGTTTGCCCCTGTTGATTTAGTGTGAGTGCATTGCTGCTTCTGTTAGTGTGGCCAT

GGAGTCTGTGCCCTGTAGTGCTCAGGTGACAAAGGGAGCAGGTATCACTGCCACAGCAAGGAGCCACCCCAGGCCCATTGCTGACCTCCCCTCTCCCTTA

CTCCACATTCCCCTTGCTCAGACACTTGAAACATTTTCAGTGCTAGGCTTTTGAGGAAGGGTTGGGGCAGGTCTCTCTAGCATGAAGTGTGTGTTTGTGT

TTGTATAGCTGGGCACGGTACTCATGCCTGTTAGCAGTCAAGAGCTATAGGAGGAGGGTTGACATGAGTGCAAGGCCAGCCTGAACTACATTGTGTGAAC

CTGTCTCAAAAACCACAAAAATTAGACACCTGAGCATTGTGCCTCGTGCCTGTAATCCCCACTCAGAGGATCACTGGGGGTCTCAGATGAGACTTCTAGG

CAATACAGTGAGATGTACTCTAGGGCAACATGGACCACAGAGACTATATAGTCCAGGATGTCTTGTACTGTAGTCCCTTGTATGTCTTTTTATGAGGTCC

TGGGTTCAATCCCCAGGACTGCAAAAAACAATATTTAAACGTCTTATAGACAGGATGTGATAGTACATGTCTACAGTCCCAGAACTGGGCGAGGGAGGCA

AGAGGTCAGACGGCGAGAGTCATCCTTGGCAATTTCTCAAGTTTGAGGCCTGCTTACACCAAAGTGGGAGAGGAATAAGCACTCAGAGAGGGATTGGGGT

AGGTGATGGGTAACGTAGAATTGCTTGCCTTATTGTACAGGTGCCAAGTACACTTTTGAATAACTGTTGAGAATAGGTTTCCTGATTAGTGATCATGAAG

AAAACATGCATTTTTAACCTGGAAAGAGCTTGGCAGTTAACATGGTTCTGGTTACCTTGATTAGTGGGATAATTTGTTGCAGTGTTTCAGAGGTATAGAA

TCATTTTTGGCTCAAAATAGACTGAAAACATAATTCTCCAAATCACATTTAACAAAATTGAATATTAGAGGTTTATAGGCAAAAATAACCATTTTGAAGT

TAACCTTGACTGCTAGCACTGTCTGCTCCAGGGATCTGAGCATCAGGGATGATCTAGTGTGTAGAGAGTGTTGTGGGAGCACAGGGAGGAGGCGTGTGAG

GTTGAGGATCCGTCTGCTGTGGATTCTTCTGTTTGCAGCGCTCTTCTGAGACACCCAGGAAATGGGGTGCTAGCAGTAAGCTATTGTGAGTGGCATTTCA

GAGCCTTGGTAACTAGAGGGAGCAGGTTTCTTTGTAGGTGGCTTTTGTTTACATCCTTAGAGCACATGTTGAGTTTAATTTCCTTCCTTCTTTTAAAGGA

ATAGATGCTAACTGCAGAGGATAACTGTACCTAACCACCTCGTTATCTCAAGTAGTATCTGTGGGGATGGGATCTGTCCATCTAGTCCTCCCTTCTGAGC

AGGGCTTCTTTCCACCTTTAAGGAGGACCAAGTTTCATTGTTCCAAGTCACTTTTGAGCATGAGGTCTCTGAGTTAGAAAAGGAGAGACAGACAGTGTCT

GACAGGAAAGAGGTTCTCTTTTATTTACTTTAATAGATGCCTATCATCTCAAAAAGGAAGTAGGCTTTCCTTTCGATTAGACTGCAGTGAGTGGGAGAGG

GTGATTTCAGTTAGTTAGAGATTATTATTGAATAGTCAAGCACAGGGCAACGTGAGAAATCCCAGCACTTGGGATTCAGAGTTAGAGGCCATCCCGGGCT

ACACGAAGGCAGTATCTTAGAAACAAAAGATGCGGCTGGAGAAATGGCTCAATGGATAGGCAAAAAGAGGGTCCAGTGACCCTCCAAGTGGGGATTACAG

CATGAGGCACAATGATCAGCTGTCTTGTTGCTATATACAAATTTGAAGGTCCAAATTCAGATCTTAGCACCCACTCTAACAAACCATGCATGGTCTCAGG

TGCACCTGTATCCCTAGTCCTCTAGAAGGATGAGGCAGGAGGATCACTGGGGCTTGCTGGCTGCCAGCCTTGCCACAAAGGTGAATTTCAGGTTCAGGGA

GAGACGCTGTCTCAAGTGAACAGGCAGAAAGTAATGGAGGACCCGATGTTCTCTTCTACCCTGAACCTAGACACACATGCATGTACACCACACTCACATA

TAGACAGCACACACAAACGCCCAAATAAGTAGAAATTAAATATTGAATACATTAATATCATTTTATGACTTCACATAACCTTCCAAGTCAGCTTTTTTTG

TTTGTAGCTCTTCTAAAAACTGGGCTCTACTCTGTAGCTCAGACTTGCCTCAGACTCAGGGCAATCTTTCTGCCTTGGCCTCTTGAGTGCTAGGACTGTA

GGAGTGAACCGCCTCATCTGGCTTGGGTTGGTGGAGAAGATGACTCTTAGATCTTCTGAGTTAAGACATGTTAGCGGATTAGTGGAGCTGGGTTAGTGGG

AATCACGTAGCAGAGGAAGTGTTCAGAGCTGGGCCTCCAGCAGGGAGAAGGCCAGGCTTAGGCCTCTACAGTAAAGCTGCTTTCAGGAATACAGTGTTAA

GTCAGGGCTGTAGATTAATACAGGGAATTATAGACCCTACATTTGCATTTTGGTTATAAGAGAAAGAACTGTAGCTGGGCAGTGTTAGCGCACGCCTTTA

ATCCCAGCACTTGGGAGGCAGAGGCAGGCAGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAAGGCTACACAGAGAAAC

CCTGTCTCAAAAAAAAAAAAGAGAGAGAGAGAGAGATGTGTTACAATATCTGTTCTTCCTGGCTTTGGGAAATTGTGCCTTCCCTCCATGTTCCTGCCTC

TGGGGGGGTCTCATTATTGCAAGGTCAGAGCAGAGACCACATGGCTGACATAGGAGAAAGCAGCTTTATGGGGTTTTGCTCTGAACTCTGTGCCTTAAAA

GACACCTTTCTGTCAGATGTATATTTACTTTTCTGTTTTGTTTCCAAACAGTCTTACTATGTAGCTCTGGCTGCCTGGAACTTGCTGTGTAGACCAGGCT

GGCTCAAATGTTTAGAGACCCCCCTGCTTCTGCCTCCACCTCCCAAGTGCTGGAATTAAAGGCACCTGGCAACAGACAGTTTTTATATCCCTTTGCTGCG

TGCACATTAGTGTATTTGTATGTAAATAAATACATAATGGATCTTCCTCCGTTTTCTCTTTAAGATTCAGCTCTAAATTATCTGGGATAACCTGGAAGCT

TTATTAAGTTACATAGGGTTTCTTTGAATTCCCTTAATCCAAGTGTGGGGGGCGGGGTATACATGCGTTGCTGTGGGTGGGGGAAGGCTGTAGAGGGAGC

ATTAAGGAAGTTGAGGCCCGAGGAGATGGTCCATGTTCGTGGGGAAGCAAGAAAATAAATGCAAAGGCTCCTTGTCAGTGCACAGTGATAGGGACCAAAG

TGAGCCACCATCATGGCTGGCTGCCTTTATACCTGTTGAAGAAAACCCCTCAGAGCCAGGCGTGGGGCACACACCTTTAATATTGCACTCAGGAGGCAGA

GACAGGTGGATCTCTGAGTTCCAGGCAGCCTAGGGCTGTACAGTGAGACCCTGGCTGGGTAGGAAATGAAAAACCCTTTAGCTTCCAGACAGGAAAGCCC

AGATGAGGGGCTGTGGATGGACAGATGGCCTAGGCTCTGCATTCCCAGCTCAGAATCTCATGTTGAGAGAGAACTCATTCTAAGAATGCCAAGGTGGACA

TCCCCTAACATCAGCCACTTCCAATGCTGTAAGAACTGAGGCACGTGGTGAACTCTGGTCACTTTCTGTCCTGATGTTTCAGAGAGTAGCTTGCAGTTCT

CTACTTGAGCAGATGAATTTACACCAAGGCTGCCAGCATGCACTTTAAGCTCTTACCTCTATTTTGTTTTTTGTTTTTCTTTGAATTGGGGTCTCACTCT

AGCCCCGACTAGCCCAGGACTCACAGCAATCCTTATGCCTTCATCTCCCATGTACTAAGATTACAGACTGAGCCACCATGCCAGATCGGCTCTAGCTCCA

TTTACCGAAGTGCCTCTACCCTTTTTGGAGTTTGTGCTCCATTTCTTGTGACTATCCTTACCAGGAGACCAAAAGCAAGAAGGATGTGAATTAGAATTAA

ATAGCTTTGAGCCTCTGGTGCTGCCCTTTCAAAGGTTTTAACCTCTCTAGGGTTAGGGGAAGGAAGATAATTCCTAAACTCTACACAAGTAATTAGGCTT

GTTAATAGCAGGAAATTGTGATCCTCTCTGTCTTCCCTGTTTCCAATCCCCTACTGTTTCTGCCATCCCATGGCTCTTGTCTTTGGAAGGCTTTGCCAGG

CACTGGAACATAATTAGTTGGTCATCTCTAGTCTGTGGGACTCACCTTTCCTTTCTCTCTTTTCTCCTTCCCAACCACATATTTTGTTCTGATGTGATTT

GTTTCTGAGAATTAAGTAGGTTATACTCTATATTTCCACTTAGTTTCTGACATCTTGCTATGTCAACTGTTACAGTAGCAACTCTGCTCCCTGGCCTTGC

TCAATGTGTCCTTCTGCCAAGGCCATGTAGGGGTGGGTAGCCCAGGATTCTTTTCACAGTGTCCTCTTGTTTTTCAAGTTGTCTGGCAGCTTTATGTACA

ATAAACGTTCAGGAAAACAAAAGTTTCTTTTTTAGGATAAAATAGTTCAATTCTGATGAGCAAGCTTATATGTACATGTGTGTGGATATGCATTTGTGTA

TATATACCTATACAGATCTATATTATATATACAATTTTGTACTATCATTTAAAATAAAGACATTTCTT
Translation
 - UNI14182 - MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDW - UNI14182 - - UNI26100 - LGTSPLHLAAQYGHYSTAEVLLR

AGVSRDARTKVDRTPLHMAAADGHVHIVELLVR - UNI23830 - - UNI26100 - SGADVNAKDMLQMTALHWATEHHHRDVVELLIKYGADVYA

FSKFDKSAFDIAMEKNNTEILVMLQ - UNI23830 - EAMQNQVNTNHERANPVANPVTVTAPFIFTSGEVINLASFVSSANTKATSA - UNI592 

- AHLEEMEEGNSLDSSTQQVVGSGGQRVITIVTDGVPLGNIQTSLPAGGIGQPFIVTMQDGQQV VLTVPAGQVAEETIIEDEEEEEEKLPLVKRPRMA

EMTNRVEEMK EGSERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLRLEAMAQQQTNGVEVDVTVVEEVAEVDAVVVTEGDEVERATQVMKSGRTTE

PHTNVSIETISS

For any suggestions or comments, please send an email to unitrap@crg.es