Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038807 (Garnl4)
Chromosomal location
Chr 11: 74196858 - 74403688 (-)
Description
GTPase activating RANGAP domain-like 4 Gene [Source:MGI (curated);Acc:Garnl4-001]
RefSeq_dna
NM_001015046 
RefSeq_peptide
NP_001015046.1 
UniGene
Mm.401284 Mm.425690 Mm.405906 
MGI
MGI:3028623 
Uniprot/SWISSPROT
Q5SVL6 
Uniprot/SPTREMBL
Q5SUE5 
Human Ortholog
ENSG00000132359 (GARNL4)
Omim not available
UniTrap UNI33541
Vector Insertion
Chr 11: 74380717 - 74403584
Public Clones IST14436F10 (tigm) IST10817C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31115
Vector Insertion
Chr 11: 74298388 - 74380754
Public Clones IST11327E10 (tigm) IST14782H7 (tigm) IST12499D7 (tigm) IST14738G3 (tigm)
IST12501D7 (tigm) IST14830F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047488
Sequence
TTTGTGCCGGCCGGTGTGCGCGTGTGCGCGCCGCGGTGACGGTGCACGCGGCTGGGCGGGCTGCGAGGGAACCCCGCGTTGAGGAGGAGGGGGCTCGGTC

CTGATGGAGAGCTGTGGGCGCCGCGCCGACCAGCGCGCGCGTTGGGTGAGCCGGCAGGACTGACTATTGACATTCTGTCCACGTCGGGAGTGTGGGAAG 

- UNI31115 - - UNI33541 - GATTGACAAGACCATGCTGGCGGGTCTGAAGGTCAA - UNI31115 - - UNI33541 - GAAGCAGGAGC

TGGCCAACAGCTCGGATGTGACCCTCCCAGATCGGCCACTGTCCCCTCCTCTCACTGCTCCCCCGACCATGAAG - UNI31115 - TCTGCGGAGTTC

TTCGAGATGCTGGAGAAAATGCAG GGAATCAAGCTTGAAGAGCAGAGGCCAGGACCCCAGAAGAACAAG GATGACTATATCCCGTACCCCAGCATTGA

TGAG GTTGTGGAGAAGGGAGGCCCATACCCTCTGATCATCCTGCCTCAGTTTGGAGGCTACTGGATTGAGGACCCAGAGAACGTGGGTACTCCAACGTC

ACTGGGCAGCAGCGTCTATGAGGAGGAGGAAGAGGACAGCCTGAGCCCCAACACATTCGGCTACAAGCTCGAGTGCAGGGGTGAAGCCAGGGCCTACCGC

AGGCACTTTCTAGGCAAG GATCATCTAAACTTTTACTGTACTGGCAGCAGCCTGGGGAATTTGATCCTGTCCATCAAATGCGAGGAAGCTGAGGGCATG

GAGTACCTTCGGATCATCCTCAG GTCCAAACTGAAGACGGTGCATGAGAGAATCCCCTTGGCTGGATTGAGCAAGTTGCCCAGTGTCCCTCAGATTGCC

AAG GCTTTCTGTGATGATGCAGTGGGGCTGAAATTCAACCCTGTTTTGTACCCCAAG GCCTCCCAGATGATTGTGTCCTATGATGAGCATGATGTCAA

CAATACTTTCAAGTTTGGGGTCATTTATCAAAAAGCCAGGCAG ACCCTGGAGGAGGAGCTATTTGGGAATAATGAGGAGAGCCCAGCTTTCAAGGAGTT

TTTGGATCTCCTGGGAGACACCATCACACTGCAGGATTTCAAAGG TTTCCGAGGAGGCCTGGATGTGACCCACGGACAGACAGGGGTGGAGTCGGTGTA

CACCACTTTCCGGGACCGGGAGATCATGTTCCATGTGTCTACCAAGCTGCCCTTTACGGATGGTGACACCCAGCAG CTGCAGAGAAAGCGGCATATTGG

GAATGATATCGTGGCCATCATCTTTCAAGAAGAAAATACACCGTTTGTCCCAGATATGATCGCATCAAACTTCTTACATGCCTACATTGTCGTTCAGGCT

GATAACCCCGGCACAGAGACCCCATCCTACAAG GTATCAGTCACTGCTAGGGAAGATGTGCCTGCCTTTGGTCCCCCTCTGCCAAGCCCGCCTGTTTTC

CAGAAG GGCGCAGAATTCCGGGAGTTTCTGCTCACCAAGCTCACGAACGCAGAGAATGCTTGCTGCAAGTCGGACAAGTTCGCCAAGCTGGAG GACCG

GACCCGGGCTGCTCTCCTGGACAACCTTCATGATGAACTCCACACACACACTCAGGTCATGCTAGGCATGGGCCCGGAGGAGGACAAGTTCGAGAATGGG

GGCCATGGAGGATTCCTGGAATCTTTTAAG AGGGCCATCCGTGTGCGCAGCCATTCCATGGAGACCATGGTGGGTAGCCAGAGGAAGCTGCATGGCGGG

AACCTCCCTGGCAGCCTCAGCGGGGGCATTGTCCACAACAGCATGGAGGTCACCAAGACCACCTTCTCG CCTCCAGTGGCCGCAGCAACCGCGAAGAAC

CAGTCACGGAGCCCCATCAAGCGGCGGTCGGGACTCTTCCCCCGCCTGCACTCGGGCTCTGAAGGCCAGGGAGACAGCCGGACACGATG TGACAGTGCC

TCCAGCACCCCCAAAACCCCAGATGGCGGACACTCTTCTCAGGAGATAAAGTCTGAGACCTCGTCAAATCCCAGCTCTCCAGAAATTTGTCCCAACAAAG

AGAA GCCCTTCATCAAGTTGAAGGAGAATGGCCGTGCCAACATCTCCCGCTCCTCCTCCAGCACCAGCAGCTTCAGCAGCACAGCAGGGGAGGGCGAGG

CCATGGAGGAGTGTGACAGTGGG AGCAGCCAGCCATCCACAACCTCGCCCTTCAAGCAGGAGGTGTTTGCCTACAGCCCATCCCCGAGCAGCGAGAGCC

CCAGCCTGGGGGCTGCCGCCACGCCCATCATCATGAGCCGGAGTCCCACAG ATGCCAAAAGCAGAAACTCCCCGAGGTCCAACCTGAAATTCCGCTTTG

ATAAACTCAGCCATGCTAGCTCCAGTGCG GGTCACTAATGTGAAAGTGAAGACCTTCCCTTATCCAAG GGAAGTGTGGATTCTGGCCTACAGAAGGCT

CCTAATTCCAGCAGTTTGGGGGTGCCATCCACTACTCTGACCGTTTAGGCCTGCTGTCTCACTGGCCACCTGCCCAGCGCACCAGCTGTCTGTTCCACGT

CCTGACCTGGCCATGACCTTGCCAGATCCTTCTCCAGACCTGAAAGCCCCAACCTGTGCTTCTGACCTCCTGATGTGACCGGCTATCTGAGTCAACTAGC

ATCTTGTTTTACATGCAGGAAAAGATCTGGGCAAGGGGGACTCTGAGTCCCAGGGGGCTCAGCGAGAAGCTAGGGAGCTCGTCTGCCCCAGGGACAGAGA

GGGTTGTGTGGTGGGGAGCAGAGGTAACTGCAGAATGGTGGGTGGGTACTGTCTGTCTTGGGTCGCAGTGCAGTGCCTTCCTGGACTGCTTTTCCAGGAA

TATCCCAGTATCCTCTGGGTTGAATCTTACTGTATTTCCGACACATCTGCCAGCCCAGGCCTAGGGAGCTCTGTCACTTCTGCCAGGGCCCCCTCAAGAG

GCTCAGGCTGGTGGACGCTCCCAGTCAGAGCTAGGTGTTCTAGAACCCGGCTGCATGCTCCCTTGACTGTAGTCTCAAGGTTTTTTCCTTTCTAATTCTA

CACAAGCTGCTGATTATCTATGTGGTTGGAGGAGCCCTGGTAGTGGGCATCCAGGAGTGTGGAGTCCAAGGTGAACACAAGGCCAGTGCAGGAGCCTCTG

GGTGAGAAGGCTCATTAGGGGTTCAGGTCTCCACTTGTGTGAGAATTTGGAAAAGACATAGTTTAAGCCATGTCTTAGGTGAGAGAGGGGGGAGATGTAG

TGGAGAGTGTCTTGGCAGTTTTTGGTCAGCCAAGTGTGTGGTGGTTGAATTTAGTGTTGGAATCAATACAGTGTTCTTCCACCTCTGAGGTCCTGTTACC

CGTGAGGGGACCAGTACTGCCCAGGGACTGATTCTAGGCTCAGTCCCCTAGTCTTCATCCTTCCATCTCCAACTGCAGGTTTTTAGGCCATTGTCCCATC

TTCAGGGCCCCTGGAAGCCCAGACCCCACGAGCCTGCGCTTTAAGCCACAGGCCATCTGTACTCCTTGTCATGGCTGCCTTCTCTGGGTGAGCCAGCCCA

TCCTGAAGACTGAGAAGCTGTCTTTGGCTCCTCAGTCTTCCAGGTTTGCAGGAAGGTTCTGCTGCTGGGTGTAGAATAGAGCATCCAACAGGCTAAACGC

TGGCTCTACACAGCAGGCACTTGAAGATCCCACCTCATTAAGTACACATGGGTCTGTGGCACAGGGCTGCTTGGTTCTGGGCTCCTGTGTCATCGAGCAG

ATGACAAGAATTTCCAACCAAGTGCTTTGCCTGCAGAGGCTCCTATTCCCAAGCCAAAGTACAGAAGGGTGGAACAGCCTTTGGGGCTGGTATAGTAACT

GTTTCTGCTGCCTTTGTCATCTGAGCACAGTTTTGGTCCTTCATCCCCCACGCACTTGCGTGCAGCCAGGGGAGGGGGAGCTCATCCCTCACTCCACTTA

GGAAACCTGCTTACGTGAAATACTAGTCTGGTAAGATTTGTTCTAGTTAGAAGGTCAACAGAATATCTGTTTATCTTTTATTAAAAGCCAGCGTAGCGGC

AGCCGGGGCTGGAAGAAGGCGGGTGGATTCTGGCAGTGTTCTGCTGGCAGGTTTCTGCTTGAACTTGAAAGGTCAAACCGTGTTTTCTTTGAAACTATTA

CAGGACTCTGGCTCCCTTCTCTGTGTTGGGCAGTTTTCCCCACTTGGTGATTGTGCTATGTTGTATTGTGGTCTGGGGCTCTTCAGGGGCTTTCAGGTTG

TCCCACGCTGTCTGGAAACCTTATAAGCCTCGTCCCCACTGCTTTGGCTACTCTGCCTGCAGGCATTACCTCTGGGCTGGATGACTGTGTGCTGAGGAAC

TGAGAGGCCCTGGCTGTGGTCCTCACCCTTGGTTTGCTGCTGAGGTACTCTGGGCAGGATATGAGATGCCCCTGCCCTCTGCTCATGCCTCTCTCTATCT

AATAGGTCATCCTGTGGCTTCCAGAGTAGGTACCGCCAGCCCAGCTCAAGTTCTCTGCTTAACGGGAGTAGAATAATGGCAGGGCCCAGTCTCCTCTCAG

CCCTCTGGGCTGGAGGCTGTTCCTCCACACTCTGATCCAGTCTTTCCTTTCATGGCTGTACCAAGTCTTAGGGCTCCGAGCCTTGCTGAGGCCCCTTCAT

GTGACTGAGCCTCTGTAGCCGATACTTCTGCTTGGATGTGGGGGGACATTTCCACTGTTACTTCCACAAGGGGTTCTCCTGGTCACAACTCTGGAAACTA

TATTTTGCAGGTGTTAATAGGCATCCAGATGCCCCCAGCTCTGTTGATACACTAAAGCAGATGTGGGAGGGCTCCAGATAGAAGGCCTTAGCCAGAGTTT

CTCTCTCTGTGATAATGAATGTCAAATGGTGTTTCTTGGAAAACCATCTGGACTTCAGTTTTGTGGGCCCTTTTTGATACTCAAGCCTCCTAGGCCCTGT

TTGCATCTCAACAGACCATGTCATCCTCCAGATGAACAGAAAGAACTTGCCTGAGGCCACACAGCCGCCTTGAGCCCGTTCCTGCATACCAACTGTACTT

ACTGTTGGCACAGCAAGCAGTTGCATTTCCTGGAGCCTGGGTTTTGAGGAAGCCTGGTAGCTGGGGTCTCTGCACTGGCGGGCAGGTGCTGAGGTCCGAG

GTATTGATAGGGCCTCTGCCTCTGCTCTTTTCCAGCATGACAAGCTTCGATCAGTGAGGACCCGGGGGCTTGGGAAATGGAGGAGGAGGGATTGCAGTCA

AGTGCTTCTTTGGGTTTTCAGTGACTGGGACAAAGTCATCTGGACAAAATGCATTAGCTACCCTTGACTTCTTTGTTCGAAATCAGGACAGAAGATGATA

AAATGAACTAATTCTCTGATATATCTTTTCTTCCTCCCTCTCTCCATCCCTCCCTTCCTCATTTTTTGGTGGTGCTGGGAACGTCCCCAAGGCCTTGCTC

ATGCTGAGTGAGGGCTCTGCCGCTGAGTCTAGGCCCAGGCCTCTCCAGGTTTTAAAATGGAGATGGGTAATAAAAGCCCAGCTCAGGTGACCAGGCAGGG

CACAGCCAGTGTCATTTTCTTTTCTTTGACCCTTTATGGTGCCAACTCAAACATCACCTTTTGTCCTTTGTTTCTTGGTCTGCAAAGACAGCTGTGTTGT

GTGTACGTGTGTTGGGTCCTGGGGTTCCGATAGAACATATGGCTTCTGGGCCAGCAGCAACCAGGTTAGTTAGCCATACTCTGGAACCCCATGTTCCCTC

CCCAGCTTCTAGTTACCCCTCAATCAAAGACAAAGACAGGTTGGCACAATGAACAAGGCTGATCCTGCCGCCCACTCGGTGGAGGGCTTCTGAGGCATCC

TACGAAACTCTGGTGTCTGTTTTGCCACCAGCCGCTTGCCCACACCAATCCCGTGTCTCTTTGCAGCCAGGCTATGTGCTTCTTTGGATGCCCAGAGCCA

AGGGCCGTCTGCAGTGAGTAGTAGCTGGGGCAGTGGCTTTGACCTGGGCCTTAACACCCCCAGCGGATAGTGCGCTTGGCTGCAAGACTGGAATCAGTTG

CCATTGTCTTTGGTTCTGTGACATTTCCACTTGAAAGGGTGAAATTCCCCTTCCCACTCCTTAGCGTCTATGCCAACTTGTGATGTCCCCGCCTGATCTC

CAGCTCCCAGGGTGCCGGGGTTGCCATGTGAAGAGATGCCCATGTGGTAGAACCTAAGAGGTGTAGTTTGAAAGTGACCCCTGTGACGATGACTTTTCTT

TGCTTCCTCTCAGTGAGGGGGGTGATTTGTAGATCCTGACTGCCTATGTGATGTAAATAGTGTACATCTAATTTATTGCTATGGTAGCACATTGTATTTG

TTAATGTATAAAACAAATTCTAAAAGGTTGAAAATGTATATTTTGTTGCTTAAATGTGTCTTTGCAGAAATTGACAATAAATAACATATTTTGTGTCCA
Translation
 - UNI31115 - - UNI33541 - MLAGLKVK - UNI31115 - - UNI33541 - KKQELANSSDVTLPDRPLSPPLTAPPTMK - UNI311

15 - SAEFFEMLEKMQ GIKLEEQRPGPQKNK DDYIPYPSIDE VVEKGGPYPLIILPQFGGYWIEDPENVGTPTSLGSSVYEEEEEDSLSPNTFGYK

LECRGEARAYRRHFLGK DHLNFYCTGSSLGNLILSIKCEEAEGMEYLRIILR RSKLKTVHERIPLAGLSKLPSVPQIAK AFCDDAVGLKFNPVLYPK

 ASQMIVSYDEHDVNNTFKFGVIYQKARQ TLEEELFGNNEESPAFKEFLDLLGDTITLQDFKG GFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKL

PFTDGDTQQ LQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQADNPGTETPSYK VSVTAREDVPAFGPPLPSPPVFQK GAEFREFLLTKL

TNAENACCKSDKFAKLE DRTRAALLDNLHDELHTHTQVMLGMGPEEDKFENGGHGGFLESFK RAIRVRSHSMETMVGSQRKLHGGNLPGSLSGGIVHN

SMEVTKTTFS PPVAAATAKNQSRSPIKRRSGLFPRLHSGSEGQGDSRTRC CDSASSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEK KPFIKLKE

NGRANISRSSSSTSSFSSTAGEGEAMEECDSG SSQPSTTSPFKQEVFAYSPSPSSESPSLGAAATPIIMSRSPTD DAKSRNSPRSNLKFRFDKLSHAS

SSA GH 
Transcript ENSMUST00000102521
Sequence
CGGCCGCCGGCGGGTGGCAGGGCGCAGCTTTGTGCCGGCCGGTGTGCGCGTGTGCGCGCCGCGGTGACGGTGCACGCGGCTGGGCGGGCTGCGAGGGAAC

CCCGCGTTGAGGAGGAGGGGGCTCGGTCCTGATGGAGAGCTGTGGGCGCCGCGCCGACCAGCGCGCGCGTTGGGTGAGCCGGCAGGACTGACTATTGACA

TTCTGTCCACGTCGGGAGTGTGGGAAGG - UNI31115 - - UNI33541 - GATTGACAAGACCATGCTGGCGGGTCTGAAGGTCAA - UNI311

15 - - UNI33541 - GAAGCAGGAGCTGGCCAACAGCTCGGATGTGACCCTCCCAGATCGGCCACTGTCCCCTCCTCTCACTGCTCCCCCGACCATG

AAG - UNI31115 - TCTGCGGAGTTCTTCGAGATGCTGGAGAAAATGCAG GGAATCAAGCTTGAAGAGCAGAGGCCAGGACCCCAGAAGAACAAG 

GATGACTATATCCCGTACCCCAGCATTGATGAG GTTGTGGAGAAGGGAGGCCCATACCCTCTGATCATCCTGCCTCAGTTTGGAGGCTACTGGATTGAG

GACCCAGAGAACGTGGGTACTCCAACGTCACTGGGCAGCAGCGTCTATGAGGAGGAGGAAGAGGACAGCCTGAGCCCCAACACATTCGGCTACAAGCTCG

AGTGCAGGGGTGAAGCCAGGGCCTACCGCAGGCACTTTCTAGGCAAG GATCATCTAAACTTTTACTGTACTGGCAGCAGCCTGGGGAATTTGATCCTGT

CCATCAAATGCGAGGAAGCTGAGGGCATGGAGTACCTTCGGATCATCCTCAG GTCCAAACTGAAGACGGTGCATGAGAGAATCCCCTTGGCTGGATTGA

GCAAGTTGCCCAGTGTCCCTCAGATTGCCAAG GCTTTCTGTGATGATGCAGTGGGGCTGAAATTCAACCCTGTTTTGTACCCCAAG GCCTCCCAGATG

ATTGTGTCCTATGATGAGCATGATGTCAACAATACTTTCAAGTTTGGGGTCATTTATCAAAAAGCCAGGCAG ACCCTGGAGGAGGAGCTATTTGGGAAT

AATGAGGAGAGCCCAGCTTTCAAGGAGTTTTTGGATCTCCTGGGAGACACCATCACACTGCAGGATTTCAAAGG TTTCCGAGGAGGCCTGGATGTGACC

CACGGACAGACAGGGGTGGAGTCGGTGTACACCACTTTCCGGGACCGGGAGATCATGTTCCATGTGTCTACCAAGCTGCCCTTTACGGATGGTGACACCC

AGCAG CTGCAGAGAAAGCGGCATATTGGGAATGATATCGTGGCCATCATCTTTCAAGAAGAAAATACACCGTTTGTCCCAGATATGATCGCATCAAACT

TCTTACATGCCTACATTGTCGTTCAGGCTGATAACCCCGGCACAGAGACCCCATCCTACAAG GTATCAGTCACTGCTAGGGAAGATGTGCCTGCCTTTG

GTCCCCCTCTGCCAAGCCCGCCTGTTTTCCAGAAG GGCGCAGAATTCCGGGAGTTTCTGCTCACCAAGCTCACGAACGCAGAGAATGCTTGCTGCAAGT

CGGACAAGTTCGCCAAGCTGGAG GACCGGACCCGGGCTGCTCTCCTGGACAACCTTCATGATGAACTCCACACACACACTCAGGTCATGCTAGGCATGG

GCCCGGAGGAGGACAAGTTCGAGAATGGGGGCCATGGAGGATTCCTGGAATCTTTTAAG AGGGCCATCCGTGTGCGCAGCCATTCCATGGAGACCATGG

TGGGTAGCCAGAGGAAGCTGCATGGCGGGAACCTCCCTGGCAGCCTCAGCGGGGGCATTGTCCACAACAGCATGGAGGTCACCAAGACCACCTTCTCG C

CTCCAGTGGCCGCAGCAACCGCGAAGAACCAGTCACGGAGCCCCATCAAGCGGCGGTCGGGACTCTTCCCCCGCCTGCACTCGGGCTCTGAAGGCCAGGG

AGACAGCCGGACACGATG TGACAGTGCCTCCAGCACCCCCAAAACCCCAGATGGCGGACACTCTTCTCAGGAGATAAAGTCTGAGACCTCGTCAAATCC

CAGCTCTCCAGAAATTTGTCCCAACAAAGAGAA GCCCTTCATCAAGTTGAAGGAGAATGGCCGTGCCAACATCTCCCGCTCCTCCTCCAGCACCAGCAG

CTTCAGCAGCACAGCAGGGGAGGGCGAGGCCATGGAGGAGTGTGACAGTGGG AGCAGCCAGCCATCCACAACCTCGCCCTTCAAGCAGGAGGTGTTTGC

CTACAGCCCATCCCCGAGCAGCGAGAGCCCCAGCCTGGGGGCTGCCGCCACGCCCATCATCATGAGCCGGAGTCCCACAG ATGCCAAAAGCAGAAACTC

CCCGAGGTCCAACCTGAAATTCCGCTTTGATAAACTCAGCCATGCTAGCTCCAGTGCG GGTCACTAATGTGAAAGTGAAGACCTTCCCTTATCCAAG G

GAAGTGTGGATTCTGGCCTACAGAAGGCTCCTAATTCCAGCAGTTTGGGGGTGCCATCCACTACTCTGACCGTTTAGGCCTGCTGTCTCACTGGCCACCT

GCCCAGCGCACCAGCTGTCTGTTCCACGTCCTGACCTGGCCATGACCTTGCCAGATCCTTCTCCAGACCTGAAAGCCCCAACCTGTGCTTCTGACCTCCT

GATGTGACCGGCTATCTGAGTCAACTAGCATCTTGTTTTACATGCAGGAAAAGATCTGGGCAAGGGGGACTCTGAGTCCCAGGGGGCTCAGCGAGAAGCT

AGGGAGCTCGTCTGCCCCAGGGACAGAGAGGGTTGTGTGGTGGGGAGCAGAGGTAACTGCAGAATGGTGGGTGGGTACTGTCTGTCTTGGGTCGCAGTGC

AGTGCCTTCCTGGACTGCTTTTCCAGGAATATCCCAGTATCCTCTGGGTTGAATCTTACTGTATTTCCGACACATCTGCCAGCCCAGGCCTAGGGAGCTC

TGTCACTTCTGCCAGGGCCCCCTCAAGAGGCTCAGGCTGGTGGACGCTCCCAGTCAGAGCTAGGTGTTCTAGAACCCGGCTGCATGCTCCCTTGACTGTA

GTCTCAAGGTTTTTTCCTTTCTAATTCTACACAAGCTGCTGATTATCTATGTGGTTGGAGGAGCCCTGGTAGTGGGCATCCAGGAGTGTGGAGTCCAAGG

TGAACACAAGGCCAGTGCAGGAGCCTCTGGGTGAGAAGGCTCATTAGGGGTTCAGGTCTCCACTTGTGTGAGAATTTGGAAAAGACATAGTTTAAGCCAT

GTCTTAGGTGAGAGAGGGGGGAGATGTAGTGGAGAGTGTCTTGGCAGTTTTTGGTCAGCCAAGTGTGTGGTGGTTGAATTTAGTGTTGGAATCAATACAG

TGTTCTTCCACCTCTGAGGTCCTGTTACCCGTGAGGGGACCAGTACTGCCCAGGGACTGATTCTAGGCTCAGTCCCCTAGTCTTCATCCTTCCATCTCCA

ACTGCAGGTTTTTAGGCCATTGTCCCATCTTCAGGGCCCCTGGAAGCCCAGACCCCACGAGCCTGCGCTTTAAGCCACAGGCCATCTGTACTCCTTGTCA

TGGCTGCCTTCTCTGGGTGAGCCAGCCCATCCTGAAGACTGAGAAGCTGTCTTTGGCTCCTCAGTCTTCCAGGTTTGCAGGAAGGTTCTGCTGCTGGGTG

TAGAATAGAGCATCCAACAGGCTAAACGCTGGCTCTACACAGCAGGCACTTGAAGATCCCACCTCATTAAGTACACATGGGTCTGTGGCACAGGGCTGCT

TGGTTCTGGGCTCCTGTGTCATCGAGCAGATGACAAGAATTTCCAACCAAGTGCTTTGCCTGCAGAGGCTCCTATTCCCAAGCCAAAGTACAGAAGGGTG

GAACAGCCTTTGGGGCTGGTATAGTAACTGTTTCTGCTGCCTTTGTCATCTGAGCACAGTTTTGGTCCTTCATCCCCCACGCACTTGCGTGCAGCCAGGG

GAGGGGGAGCTCATCCCTCACTCCACTTAGGAAACCTGCTTACGTGAAATACTAGTCTGGTAAGATTTGTTCTAGTTAGAAGGTCAACAGAATATCTGTT

TATCTTTTATTAAAAGCCAGCGTAGCGGCAGCCGGGGCTGGAAGAAGGCGGGTGGATTCTGGCAGTGTTCTGCTGGCAGGTTTCTGCTTGAACTTGAAAG

GTCAAACCGTGTTTTCTTTGAAACTATTACAGGACTCTGGCTCCCTTCTCTGTGTTGGGCAGTTTTCCCCACTTGGTGATTGTGCTATGTTGTATTGTGG

TCTGGGGCTCTTCAGGGGCTTTCAGGTTGTCCCACGCTGTCTGGAAACCTTATAAGCCTCGTCCCCACTGCTTTGGCTACTCTGCCTGCAGGCATTACCT

CTGGGCTGGATGACTGTGTGCTGAGGAACTGAGAGGCCCTGGCTGTGGTCCTCACCCTTGGTTTGCTGCTGAGGTACTCTGGGCAGGATATGAGATGCCC

CTGCCCTCTGCTCATGCCTCTCTCTATCTAATAGGTCATCCTGTGGCTTCCAGAGTAGGTACCGCCAGCCCAGCTCAAGTTCTCTGCTTAACGGGAGTAG

AATAATGGCAGGGCCCAGTCTCCTCTCAGCCCTCTGGGCTGGAGGCTGTTCCTCCACACTCTGATCCAGTCTTTCCTTTCATGGCTGTACCAAGTCTTAG

GGCTCCGAGCCTTGCTGAGGCCCCTTCATGTGACTGAGCCTCTGTAGCCGATACTTCTGCTTGGATGTGGGGGGACATTTCCACTGTTACTTCCACAAGG

GGTTCTCCTGGTCACAACTCTGGAAACTATATTTTGCAGGTGTTAATAGGCATCCAGATGCCCCCAGCTCTGTTGATACACTAAAGCAGATGTGGGAGGG

CTCCAGATAGAAGGCCTTAGCCAGAGTTTCTCTCTCTGTGATAATGAATGTCAAATGGTGTTTCTTGGAAAACCATCTGGACTTCAGTTTTGTGGGCCCT

TTTTGATACTCAAGCCTCCTAGGCCCTGTTTGCATCTCAACAGACCATGTCATCCTCCAGATGAACAGAAAGAACTTGCCTGAGGCCACACAGCCGCCTT

GAGCCCGTTCCTGCATACCAACTGTACTTACTGTTGGCACAGCAAGCAGTTGCATTTCCTGGAGCCTGGGTTTTGAGGAAGCCTGGTAGCTGGGGTCTCT

GCACTGGCGGGCAGGTGCTGAGGTCCGAGGTATTGATAGGGCCTCTGCCTCTGCTCTTTTCCAGCATGACAAGCTTCGATCAGTGAGGACCCGGGGGCTT

GGGAAATGGAGGAGGAGGGATTGCAGTCAAGTGCTTCTTTGGGTTTTCAGTGACTGGGACAAAGTCATCTGGACAAAATGCATTAGCTACCCTTGACTTC

TTTGTTCGAAATCAGGACAGAAGATGATAAAATGAACTAATTCTCTGATATATCTTTTCTTCCTCCCTCTCTCCATCCCTCCCTTCCTCATTTTTTGGTG

GTGCTGGGAACGTCCCCAAGGCCTTGCTCATGCTGAGTGAGGGCTCTGCCGCTGAGTCTAGGCCCAGGCCTCTCCAGGTTTTAAAATGGAGATGGGTAAT

AAAAGCCCAGCTCAGGTGACCAGGCAGGGCACAGCCAGTGTCATTTTCTTTTCTTTGACCCTTTATGGTGCCAACTCAAACATCACCTTTTGTCCTTTGT

TTCTTGGTCTGCAAAGACAGCTGTGTTGTGTGTACGTGTGTTGGGTCCTGGGGTTCCGATAGAACATATGGCTTCTGGGCCAGCAGCAACCAGGTTAGTT

AGCCATACTCTGGAACCCCATGTTCCCTCCCCAGCTTCTAGTTACCCCTCAATCAAAGACAAAGACAGGTTGGCACAATGAACAAGGCTGATCCTGCCGC

CCACTCGGTGGAGGGCTTCTGAGGCATCCTACGAAACTCTGGTGTCTGTTTTGCCACCAGCCGCTTGCCCACACCAATCCCGTGTCTCTTTGCAGCCAGG

CTATGTGCTTCTTTGGATGCCCAGAGCCAAGGGCCGTCTGCAGTGAGTAGTAGCTGGGGCAGTGGCTTTGACCTGGGCCTTAACACCCCCAGCGGATAGT

GCGCTTGGCTGCAAGACTGGAATCAGTTGCCATTGTCTTTGGTTCTGTGACATTTCCACTTGAAAGGGTGAAATTCCCCTTCCCACTCCTTAGCGTCTAT

GCCAACTTGTGATGTCCCCGCCTGATCTCCAGCTCCCAGGGTGCCGGGGTTGCCATGTGAAGAGATGCCCATGTGGTAGAACCTAAGAGGTGTAGTTTGA

AAGTGACCCCTGTGACGATGACTTTTCTTTGCTTCCTCTCAGTGAGGGGGGTGATTTGTAGATCCTGACTGCCTATGTGATGTAAATAGTGTACATCTAA

TTTATTGCTATGGTAGCACATTGTATTTGTTAATGTATAAAACAAATTCTAAAAGGTTGAAAATGTATATTTTGTTGCTTAAATGTGTCTTTGCAGAAAT

TGACAATAAATAACATATTTTGTGTCCATTAGAGTTCACATTTCTTGGAGTGGGGCTCTACTAGACTTTCGGCAGGGCCTTTCACTGGAGGGTGGCTATC

AGCTTGAACCTGTTTGAAAACTTTATTAATATTAAAAACAAACAAAGCAAACAAA
Translation
 - UNI31115 - - UNI33541 - MLAGLKVK - UNI31115 - - UNI33541 - KKQELANSSDVTLPDRPLSPPLTAPPTMK - UNI311

15 - SAEFFEMLEKMQ GIKLEEQRPGPQKNK DDYIPYPSIDE VVEKGGPYPLIILPQFGGYWIEDPENVGTPTSLGSSVYEEEEEDSLSPNTFGYK

LECRGEARAYRRHFLGK DHLNFYCTGSSLGNLILSIKCEEAEGMEYLRIILR RSKLKTVHERIPLAGLSKLPSVPQIAK AFCDDAVGLKFNPVLYPK

 ASQMIVSYDEHDVNNTFKFGVIYQKARQ TLEEELFGNNEESPAFKEFLDLLGDTITLQDFKG GFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKL

PFTDGDTQQ LQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQADNPGTETPSYK VSVTAREDVPAFGPPLPSPPVFQK GAEFREFLLTKL

TNAENACCKSDKFAKLE DRTRAALLDNLHDELHTHTQVMLGMGPEEDKFENGGHGGFLESFK RAIRVRSHSMETMVGSQRKLHGGNLPGSLSGGIVHN

SMEVTKTTFS PPVAAATAKNQSRSPIKRRSGLFPRLHSGSEGQGDSRTRC CDSASSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEK KPFIKLKE

NGRANISRSSSSTSSFSSTAGEGEAMEECDSG SSQPSTTSPFKQEVFAYSPSPSSESPSLGAAATPIIMSRSPTD DAKSRNSPRSNLKFRFDKLSHAS

SSA GH 
Transcript ENSMUST00000108454
Sequence
CCGAGCTTACAG TCTGCGGAGTTCTTCGAGATGCTGGAGAAAATGCAG GGAATCAAGCTTGAAGAGCAGAGGCCAGGACCCCAGAAGAACAAG GATG

ACTATATCCCGTACCCCAGCATTGATGAG GTTGTGGAGAAGGGAGGCCCATACCCTCTGATCATCCTGCCTCAGTTTGGAGGCTACTGGATTGAGGACC

CAGAGAACGTGGGTACTCCAACGTCACTGGGCAGCAGCGTCTATGAGGAGGAGGAAGAGGACAGCCTGAGCCCCAACACATTCGGCTACAAGCTCGAGTG

CAGGGGTGAAGCCAGGGCCTACCGCAGGCACTTTCTAGGCAAG GATCATCTAAACTTTTACTGTACTGGCAGCAGCCTGGGGAATTTGATCCTGTCCAT

CAAATGCGAGGAAGCTGAGGGCATGGAGTACCTTCGGATCATCCTCAG GTCCAAACTGAAGACGGTGCATGAGAGAATCCCCTTGGCTGGATTGAGCAA

GTTGCCCAGTGTCCCTCAGATTGCCAAG GCTTTCTGTGATGATGCAGTGGGGCTGAAATTCAACCCTGTTTTGTACCCCAAG GCCTCCCAGATGATTG

TGTCCTATGATGAGCATGATGTCAACAATACTTTCAAGTTTGGGGTCATTTATCAAAAAGCCAGGCAG ACCCTGGAGGAGGAGCTATTTGGGAATAATG

AGGAGAGCCCAGCTTTCAAGGAGTTTTTGGATCTCCTGGGAGACACCATCACACTGCAGGATTTCAAAGG TTTCCGAGGAGGCCTGGATGTGACCCACG

GACAGACAGGGGTGGAGTCGGTGTACACCACTTTCCGGGACCGGGAGATCATGTTCCATGTGTCTACCAAGCTGCCCTTTACGGATGGTGACACCCAGCA

G CTGCAGAGAAAGCGGCATATTGGGAATGATATCGTGGCCATCATCTTTCAAGAAGAAAATACACCGTTTGTCCCAGATATGATCGCATCAAACTTCTT

ACATGCCTACATTGTCGTTCAGGCTGATAACCCCGGCACAGAGACCCCATCCTACAAG GTATCAGTCACTGCTAGGGAAGATGTGCCTGCCTTTGGTCC

CCCTCTGCCAAGCCCGCCTGTTTTCCAGAAG GGCGCAGAATTCCGGGAGTTTCTGCTCACCAAGCTCACGAACGCAGAGAATGCTTGCTGCAAGTCGGA

CAAGTTCGCCAAGCTGGAG GACCGGACCCGGGCTGCTCTCCTGGACAACCTTCATGATGAACTCCACACACACACTCAGGTCATGCTAGGCATGGGCCC

GGAGGAGGACAAGTTCGAGAATGGGGGCCATGGAGGATTCCTGGAATCTTTTAAG AGGGCCATCCGTGTGCGCAGCCATTCCATGGAGACCATGGTGGG

TAGCCAGAGGAAGCTGCATGGCGGGAACCTCCCTGGCAGCCTCAGCGGGGGCATTGTCCACAACAGCATGGAGGTCACCAAGACCACCTTCTCG CCTCC

AGTGGCCGCAGCAACCGCGAAGAACCAGTCACGGAGCCCCATCAAGCGGCGGTCGGGACTCTTCCCCCGCCTGCACTCGGGCTCTGAAGGCCAGGGAGAC

AGCCGGACACGATG TGACAGTGCCTCCAGCACCCCCAAAACCCCAGATGGCGGACACTCTTCTCAGGAGATAAAGTCTGAGACCTCGTCAAATCCCAGC

TCTCCAGAAATTTGTCCCAACAAAGAGAA GCCCTTCATCAAGTTGAAGGAGAATGGCCGTGCCAACATCTCCCGCTCCTCCTCCAGCACCAGCAGCTTC

AGCAGCACAGCAGGGGAGGGCGAGGCCATGGAGGAGTGTGACAGTGGG AGCAGCCAGCCATCCACAACCTCGCCCTTCAAGCAGGAGGTGTTTGCCTAC

AGCCCATCCCCGAGCAGCGAGAGCCCCAGCCTGGGGGCTGCCGCCACGCCCATCATCATGAGCCGGAGTCCCACAG ATGCCAAAAGCAGAAACTCCCCG

AGGTCCAACCTGAAATTCCGCTTTGATAAACTCAGCCATGCTAGCTCCAGTGCG GGTCACTAATGTGAAAGTGAAGACCTTCCCTTATCCAAG GGAAG

TGTGGATTCTGGCCTACAGAAGGCTCCTAATTCCAGCAGTTTGGGGGTGCCATCCACTACTCTGACCGTTTAGGCCTGCTGTCTCACTGGCCACCTGCCC

AGCGCACCAGCTGTCTGTTCCACGTCCTGACCTGGCCATGACCTTGCCAGATCCTTCTCCAGACCTGAAAGCCCCAACCTGTGCTTCTGACCTCCTGATG

TGACCGGCTATCTGAGTCAACTAGCATCTTGTTTTACATGCAGGAAAAGATCTGGGCAAGGGGGACTCTGAGTCCCAGGGGGCTCAGCGAGAAGCTAGGG

AGCTCGTCTGCCCCAGGGACAGAGAGGGTTGTGTGGTGGGGAGCAGAGGTAACTGCAGAATGGTGGGTGGGTACTGTCTGTCTTGGGTCGCAGTGCAGTG

CCTTCCTGGACTGCTTTTCCAGGAATATCCCAGTATCCTCTGGGTTGAATCTTACTGTATTTCCGACACATCTGCCAGCCCAGGCCTAGGGAGCTCTGTC

ACTTCTGCCAGGGCCCCCTCAAGAGGCTCAGGCTGGTGGACGCTCCCAGTCAGAGCTAGGTGTTCTAGAACCCGGCTGCATGCTCCCTTGACTGTAGTCT

CAAGGTTTTTTCCTTTCTAATTCTACACAAGCTGCTGATTATCTATGTGGTTGGAGGAGCCCTGGTAGTGGGCATCCAGGAGTGTGGAGTCCAAGGTGAA

CACAAGGCCAGTGCAGGAGCCTCTGGGTGAGAAGGCTCATTAGGGGTTCAGGTCTCCACTTGTGTGAGAATTTGGAAAAGACATAGTTTAAGCCATGTCT

TAGGTGAGAGAGGGGGGAGATGTAGTGGAGAGTGTCTTGGCAGTTTTTGGTCAGCCAAGTGTGTGGTGGTTGAATTTAGTGTTGGAATCAATACAGTGTT

CTTCCACCTCTGAGGTCCTGTTACCCGTGAGGGGACCAGTACTGCCCAGGGACTGATTCTAGGCTCAGTCCCCTAGTCTTCATCCTTCCATCTCCAACTG

CAGGTTTTTAGGCCATTGTCCCATCTTCAGGGCCCCTGGAAGCCCAGACCCCACGAGCCTGCGCTTTAAGCCACAGGCCATCTGTACTCCTTGTCATGGC

TGCCTTCTCTGGGTGAGCCAGCCCATCCTGAAGACTGAGAAGCTGTCTTTGGCTCCTCAGTCTTCCAGGTTTGCAGGAAGGTTCTGCTGCTGGGTGTAGA

ATAGAGCATCCAACAGGCTAAACGCTGGCTCTACACAGCAGGCACTTGAAGATCCCACCTCATTAAGTACACATGGGTCTGTGGCACAGGGCTGCTTGGT

TCTGGGCTCCTGTGTCATCGAGCAGATGACAAGAATTTCCAACCAAGTGCTTTGCCTGCAGAGGCTCCTATTCCCAAGCCAAAGTACAGAAGGGTGGAAC

AGCCTTTGGGGCTGGTATAGTAACTGTTTCTGCTGCCTTTGTCATCTGAGCACAGTTTTGGTCCTTCATCCCCCACGCACTTGCGTGCAGCCAGGGGAGG

GGGAGCTCATCCCTCACTCCACTTAGGAAACCTGCTTACGTGAAATACTAGTCTGGTAAGATTTGTTCTAGTTAGAAGGTCAACAGAATATCTGTTTATC

TTTTATTAAAAGCCAGCGTAGCGGCAGCCGGGGCTGGAAGAAGGCGGGTGGATTCTGGCAGTGTTCTGCTGGCAGGTTTCTGCTTGAACTTGAAAGGTCA

AACCGTGTTTTCTTTGAAACTATTACAGGACTCTGGCTCCCTTCTCTGTGTTGGGCAGTTTTCCCCACTTGGTGATTGTGCTATGTTGTATTGTGGTCTG

GGGCTCTTCAGGGGCTTTCAGGTTGTCCCACGCTGTCTGGAAACCTTATAAGCCTCGTCCCCACTGCTTTGGCTACTCTGCCTGCAGGCATTACCTCTGG

GCTGGATGACTGTGTGCTGAGGAACTGAGAGGCCCTGGCTGTGGTCCTCACCCTTGGTTTGCTGCTGAGGTACTCTGGGCAGGATATGAGATGCCCCTGC

CCTCTGCTCATGCCTCTCTCTATCTAATAGGTCATCCTGTGGCTTCCAGAGTAGGTACCGCCAGCCCAGCTCAAGTTCTCTGCTTAACGGGAGTAGAATA

ATGGCAGGGCCCAGTCTCCTCTCAGCCCTCTGGGCTGGAGGCTGTTCCTCCACACTCTGATCCAGTCTTTCCTTTCATGGCTGTACCAAGTCTTAGGGCT

CCGAGCCTTGCTGAGGCCCCTTCATGTGACTGAGCCTCTGTAGCCGATACTTCTGCTTGGATGTGGGGGGACATTTCCACTGTTACTTCCACAAGGGGTT

CTCCTGGTCACAACTCTGGAAACTATATTTTGCAGGTGTTAATAGGCATCCAGATGCCCCCAGCTCTGTTGATACACTAAAGCAGATGTGGGAGGGCTCC

AGATAGAAGGCCTTAGCCAGAGTTTCTCTCTCTGTGATAATGAATGTCAAATGGTGTTTCTTGGAAAACCATCTGGACTTCAGTTTTGTGGGCCCTTTTT

GATACTCAAGCCTCCTAGGCCCTGTTTGCATCTCAACAGACCATGTCATCCTCCAGATGAACAGAAAGAACTTGCCTGAGGCCACACAGCCGCCTTGAGC

CCGTTCCTGCATACCAACTGTACTTACTGTTGGCACAGCAAGCAGTTGCATTTCCTGGAGCCTGGGTTTTGAGGAAGCCTGGTAGCTGGGGTCTCTGCAC

TGGCGGGCAGGTGCTGAGGTCCGAGGTATTGATAGGGCCTCTGCCTCTGCTCTTTTCCAGCATGACAAGCTTCGATCAGTGAGGACCCGGGGGCTTGGGA

AATGGAGGAGGAGGGATTGCAGTCAAGTGCTTCTTTGGGTTTTCAGTGACTGGGACAAAGTCATCTGGACAAAATGCATTAGCTACCCTTGACTTCTTTG

TTCGAAATCAGGACAGAAGATGATAAAATGAACTAATTCTCTGATATATCTTTTCTTCCTCCCTCTCTCCATCCCTCCCTTCCTCATTTTTTGGTGGTGC

TGGGAACGTCCCCAAGGCCTTGCTCATGCTGAGTGAGGGCTCTGCCGCTGAGTCTAGGCCCAGGCCTCTCCAGGTTTTAAAATGGAGATGGGTAATAAAA

GCCCAGCTCAGGTGACCAGGCAGGGCACAGCCAGTGTCATTTTCTTTTCTTTGACCCTTTATGGTGCCAACTCAAACATCACCTTTTGTCCTTTGTTTCT

TGGTCTGCAAAGACAGCTGTGTTGTGTGTACGTGTGTTGGGTCCTGGGGTTCCGATAGAACATATGGCTTCTGGGCCAGCAGCAACCAGGTTAGTTAGCC

ATACTCTGGAACCCCATGTTCCCTCCCCAGCTTCTAGTTACCCCTCAATCAAAGACAAAGACAGGTTGGCACAATGAACAAGGCTGATCCTGCCGCCCAC

TCGGTGGAGGGCTTCTGAGGCATCCTACGAAACTCTGGTGTCTGTTTTGCCACCAGCCGCTTGCCCACACCAATCCCGTGTCTCTTTGCAGCCAGGCTAT

GTGCTTCTTTGGATGCCCAGAGCCAAGGGCCGTCTGCAGTGAGTAGTAGCTGGGGCAGTGGCTTTGACCTGGGCCTTAACACCCCCAGCGGATAGTGCGC

TTGGCTGCAAGACTGGAATCAGTTGCCATTGTCTTTGGTTCTGTGACATTTCCACTTGAAAGGGTGAAATTCCCCTTCCCACTCCTTAGCGTCTATGCCA

ACTTGTGATGTCCCCGCCTGATCTCCAGCTCCCAGGGTGCCGGGGTTGCCATGTGAAGAGATGCCCATGTGGTAGAACCTAAGAGGTGTAGTTTGAAAGT

GACCCCTGTGACGATGACTTTTCTTTGCTTCCTCTCAGTGAGGGGGGTGATTTGTAGATCCTGACTGCCTATGTGATGTAAATAGTGTACATCTAATTTA

TTGCTATGGTAGCACATTGTATTTGTTAATGTATAAAACAAATTCTAAAAGGTTGAAAATGTATATTTTGTTGCTTAAATGTGTCTTTGCAGAAATTGAC

AATAAATAACATATTTTGTGTCCA
Translation
PSLQ SAEFFEMLEKMQ GIKLEEQRPGPQKNK DDYIPYPSIDE VVEKGGPYPLIILPQFGGYWIEDPENVGTPTSLGSSVYEEEEEDSLSPNTFGYK

LECRGEARAYRRHFLGK DHLNFYCTGSSLGNLILSIKCEEAEGMEYLRIILR RSKLKTVHERIPLAGLSKLPSVPQIAK AFCDDAVGLKFNPVLYPK

 ASQMIVSYDEHDVNNTFKFGVIYQKARQ TLEEELFGNNEESPAFKEFLDLLGDTITLQDFKG GFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKL

PFTDGDTQQ LQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQADNPGTETPSYK VSVTAREDVPAFGPPLPSPPVFQK GAEFREFLLTKL

TNAENACCKSDKFAKLE DRTRAALLDNLHDELHTHTQVMLGMGPEEDKFENGGHGGFLESFK RAIRVRSHSMETMVGSQRKLHGGNLPGSLSGGIVHN

SMEVTKTTFS PPVAAATAKNQSRSPIKRRSGLFPRLHSGSEGQGDSRTRC CDSASSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEK KPFIKLKE

NGRANISRSSSSTSSFSSTAGEGEAMEECDSG SSQPSTTSPFKQEVFAYSPSPSSESPSLGAAATPIIMSRSPTD DAKSRNSPRSNLKFRFDKLSHAS

SSA GH 
Transcript ENSMUST00000094030
Sequence
GTTGAGGAGGAGGGGGCTCGGTCCTGATGGAGAGCTGTGGGCGCCGCGCCGACCAGCGCGCGCGTTGGGTGAGCCGGCAGGACTGACTATTGACATTCTG

TCCACGTCGGGAGTGTGGGAAG - UNI31115 - - UNI33541 - GATTGACAAGACCATGCTGGCGGGTCTGAAGGTCAA - UNI31115 - -

 UNI33541 - GAAGCAGGAGCTGGCCAACAGCTCGGATGTGACCCTCCCAGATCGGCCACTGTCCCCTCCTCTCACTGCTCCCCCGACCATGAAG - 

UNI31115 - TCTGCGGAGTTCTTCGAGATGCTGGAGAAAATGCAG GATGACTATATCCCGTACCCCAGCATTGATGAG GTTGTGGAGAAGGGAGGC

CCATACCCTCTGATCATCCTGCCTCAGTTTGGAGGCTACTGGATTGAGGACCCAGAGAACGTGGGTACTCCAACGTCACTGGGCAGCAGCGTCTATGAGG

AGGAGGAAGAGGACAGCCTGAGCCCCAACACATTCGGCTACAAGCTCGAGTGCAGGGGTGAAGCCAGGGCCTACCGCAGGCACTTTCTAGGCAAGG
Translation
 - UNI31115 - - UNI33541 - MLAGLKVK - UNI31115 - - UNI33541 - KKQELANSSDVTLPDRPLSPPLTAPPTMK - UNI311

15 - SAEFFEMLEKMQ DDYIPYPSIDE VVEKGGPYPLIILPQFGGYWIEDPENVGTPT

For any suggestions or comments, please send an email to unitrap@crg.es