Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038828 (1110039B18Rik)
Chromosomal location
Chr 5: 31172004 - 31179835 (+)
Description
transmembrane protein 214 Gene [Source:MGI Symbol;Acc:MGI:1916046]
RefSeq_dna
NM_144525 
RefSeq_peptide
NP_653108.2 
UniGene
Mm.205169 
MGI
MGI:1916046 
Uniprot/SWISSPROT
Q8BM55 
Human Ortholog
ENSG00000119777 (TMEM214)
Omim not available
UniTrap UNI11476
Vector Insertion
Chr 5: 31177024 - 31177223
Public Clones P070G07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114716
Sequence
CCGGGGCCGAAAGCCGGGAGGTGGTGGAGCTGAAGTCATGGCGGCCAGATCAGCGGGTAGCGGTGGCTGGGAGGTGGTGAAGAGGGGCCGGCGACCTGGA

GCAAGCAGCGGTGGGCGAGGCGGCGGCGGTGGCAGTGACCGCCGGGCGCTCGGGGAGGCAAATGGAGTGTTGAAATACGACCTGAGCT CACCAATCCAG

ACTACAAGCACTCTTTATGAGCGTGGCTTTGAGAAAATCATGAAACGGCAGAATAAAGAGCAAGTTCCACCCCCTGCTGCAGAGTCTAAGAAACCGATAA

ACAAGAAGCAACCAAAGAAGGTGACAGCTGTTCCTAGCCAAAACCAGAAACAGGGCCCATTCCGACGCCTGGAGGACGCACTGAAAGCG CTGGATGTGG

CAGCTCTGCAGAAGGAACTGGACAAGAGCCAGAGCGTGTTCACTGGGAACCCCTCCGTGTGGCTGAAGGACCTGGCCAGCTATCTCAACTACAAGCTCCA

GACTCCACGGATGGAGCCCACTCTGAGCCAGTATCCACATG GGGAGTCGCTACATGGGTACCGCATCTGTATTCAAGCCGTTCTGCAAGACAAGCCTAA

GATTGTCACCTCAAACCTGGACAAG TTCCTAGAGCTTCTGCGGTCCCACCAGAGCCGACCAGCAAAGTGCCTGACCATCATGTGGGCCCTGGGGCAAGC

GGGTTTCACCAACCTCACTGAGGGACTGAAAG TGTGGCTGGGGATCATGCTGCCTGTGCTGGGCATCAAGGCTCTGTCTCCCTTTGCCATCGCATACCT

GGACCGGCTGCTCCT GATGCATCCCAACCTCACCAAAGGCTTTGGCATGATTGGCCCCAAGGACTTCTTCCCCCTTCTGGACTTTGCCTATATGCCCAA

CAATTCCCTGAGCCCCAG CCTGCAGGAGCAGCTGTGCCAGCTCTTCCCCCGATTGAAGGTGCTGGCATTTGGGGCCAAGCCGGAATCTTCCCTGCACAC

CTACTTCCCGTCATTCCTGTCCAGAGCCACCCCTAGCTGTCCTGCTGCCATGAAGAAAGAG CTCCTGGCCAGCCTGACCCAGTGCCTGACTGTGGACCC

CCTTAGCACTAGTGTCTGGAGACAGCTGTACCCCAAGCATCTGTCACAGTCCAG CCTGCTGCTGGAGCACCTACTCAAGTCCTGGGAGCACATCCCCAA

GAAG GCACGGAAATCTTTACAAGAAACCATCCAGTCCTTGAAGGTTACCAACCAGGAGCTTCTGAAGAAGGGCAGTGGTGGCAGTGAGCATGTTCTCAC

CTGTGACACAGCCTGCAAG - UNI11476 - GGCTTGTTGCAACGGGCACGGGGTCCTCGGCCACCCTGGGCCCGGCTATTCCTGCTGCTTCTGGTCT

TTGCAGTAGGATTCCTATGTCATGACTTGCGGTCAAACAGCTCTTTGCAGG CCTCCCTCACTGGCCGGCTGCTTCGATCCTCCGGTCTCTTGCCTGTTG

GCCAGCAAGTGTGTGCGAGACTCTCCTCCTACAGCCTGCAGAGCTACAA CTGGCTGCAGGAGACCTTGCCAGCCTGTGGCTCCCACCTGCTTGCTGTGG

TACAGCCCAGTCTGCAGCTGGCCTGGACACACATCTATGCCATATTCAGCTTCCTTTCTGCCCACTGTGCCTCCTACCTTGCCTGCTTCAGTGATAGCCT

GGCTGGCTTCTTTCAGAGG GTCCAGCTCCCTGAGGCCCTGCAGCAGCTCTTCCACGCCTTGAAGGAACTGCTGCTGCTCTTCTGCCATAGCGTGCTGCT

GCCCACATGGCACTTGCTGCTTGCAGCCCTGGCCCAAGTCCAGGAGCATTGCCATGAGGCCTGCAG AGGGGACGTGACCTGGGACTGCATTAAGACACA

GTTGAGCAGAGCTGCCCAATGGACCTGGCTCTGCCTGCAGGATGTCACAGTGGCTTTCTTGGACTGGGCACTCACCATGATATCCCAGCAATAGACCCTG

CCTGCCTGGCCACTGGTTCTGTGGTGGGCTACCTATCGGAGTAGAGGAGGCAGCCCTCTTCACTTGGTGCCTGACTTCTGCCTCCTAGGCAAGAGACCAG

GTATCTGCCTCACTTCTCCATCTTCAGGAGACTGGACAGGAGCATCCCAGCCTCCTGTCCACAGGCCTGTGAGGTCTCTCAGGCCCAGTTGCACAGCATC

CAAGCCTCTTCTAGGCTGGGAGCCTCTCCACTTCTCCCTGTGGTCCTC
Translation
MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVLKYDLSS SPIQTTSTLYERGFEKIMKRQNKEQVPPPAAESKKPINKKQPKKVTAV

PSQNQKQGPFRRLEDALKA LDVAALQKELDKSQSVFTGNPSVWLKDLASYLNYKLQTPRMEPTLSQYPHG GESLHGYRICIQAVLQDKPKIVTSNLDK

 FLELLRSHQSRPAKCLTIMWALGQAGFTNLTEGLKV VWLGIMLPVLGIKALSPFAIAYLDRLLL LMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLS

PS SLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKE LLASLTQCLTVDPLSTSVWRQLYPKHLSQSS SLLLEHLLKSWEHIPK

K ARKSLQETIQSLKVTNQELLKKGSGGSEHVLTCDTACK - UNI11476 - GLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQA ASLTG

RLLRSSGLLPVGQQVCARLSSYSLQSYN NWLQETLPACGSHLLAVVQPSLQLAWTHIYAIFSFLSAHCASYLACFSDSLAGFFQR VQLPEALQQLFHA

LKELLLLFCHSVLLPTWHLLLAALAQVQEHCHEACR RGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTMISQQ
Transcript ENSMUST00000046349
Sequence
GCTGAAGTCATGGCGGCCAGATCAGCGGGTAGCGGTGGCTGGGAGGTGGTGAAGAGGGGCCGGCGACCTGGAGCAAGCAGCGGTGGGCGAGGCGGCGGCG

GTGGCAGTGACCGCCGGGCGCTCGGGGAGGCAAATGGAGTGTTGAAATACGACCTGAGCT CACCAATCCAGACTACAAGCACTCTTTATGAGCGTGGCT

TTGAGAAAATCATGAAACGGCAGAATAAAGAGCAAGTTCCACCCCCTGCTGCAGAGTCTAAGAAACCGATAAACAAGAAGCAACCAAAGAAGGTGACAGC

TGTTCCTAGCCAAAACCAGAAACAGGGCCCATTCCGACGCCTGGAGGACGCACTGAAAGCG CTGGATGTGGCAGCTCTGCAGAAGGAACTGGACAAGAG

CCAGAGCGTGTTCACTGGGAACCCCTCCGTGTGGCTGAAGGACCTGGCCAGCTATCTCAACTACAAGCTCCAGACTCCACGGATGGAGCCCACTCTGAGC

CAGTATCCACATG ATTATCCCTACAGCCTTGTGAGCCGAGAGCTACGTGGGATCATCCGGGGGCTCCTGACCAAAGCTGCAGGGTCTGTGGAGCTCTTT

TTTGACCACTGTCTATTCACCATGCTGCAAGAGCTGGATAAAACACCAG GGGAGTCGCTACATGGGTACCGCATCTGTATTCAAGCCGTTCTGCAAGAC

AAGCCTAAGATTGTCACCTCAAACCTGGACAAG TTCCTAGAGCTTCTGCGGTCCCACCAGAGCCGACCAGCAAAGTGCCTGACCATCATGTGGGCCCTG

GGGCAAGCGGGTTTCACCAACCTCACTGAGGGACTGAAAG TGTGGCTGGGGATCATGCTGCCTGTGCTGGGCATCAAGGCTCTGTCTCCCTTTGCCATC

GCATACCTGGACCGGCTGCTCCT GATGCATCCCAACCTCACCAAAGGCTTTGGCATGATTGGCCCCAAGGACTTCTTCCCCCTTCTGGACTTTGCCTAT

ATGCCCAACAATTCCCTGAGCCCCAG CCTGCAGGAGCAGCTGTGCCAGCTCTTCCCCCGATTGAAGGTGCTGGCATTTGGGGCCAAGCCGGAATCTTCC

CTGCACACCTACTTCCCGTCATTCCTGTCCAGAGCCACCCCTAGCTGTCCTGCTGCCATGAAGAAAGAG CTCCTGGCCAGCCTGACCCAGTGCCTGACT

GTGGACCCCCTTAGCACTAGTGTCTGGAGACAGCTGTACCCCAAGCATCTGTCACAGTCCAG CCTGCTGCTGGAGCACCTACTCAAGTCCTGGGAGCAC

ATCCCCAAGAAG GCACGGAAATCTTTACAAGAAACCATCCAGTCCTTGAAGGTTACCAACCAGGAGCTTCTGAAGAAGGGCAGTGGTGGCAGTGAGCAT

GTTCTCACCTGTGACACAGCCTGCAAG - UNI11476 - GGCTTGTTGCAACGGGCACGGGGTCCTCGGCCACCCTGGGCCCGGCTATTCCTGCTGCT

TCTGGTCTTTGCAGTAGGATTCCTATGTCATGACTTGCGGTCAAACAGCTCTTTGCAGG CCTCCCTCACTGGCCGGCTGCTTCGATCCTCCGGTCTCTT

GCCTGTTGGCCAGCAAGTGTGTGCGAGACTCTCCTCCTACAGCCTGCAGAGCTACAA CTGGCTGCAGGAGACCTTGCCAGCCTGTGGCTCCCACCTGCT

TGCTGTGGTACAGCCCAGTCTGCAGCTGGCCTGGACACACATCTATGCCATATTCAGCTTCCTTTCTGCCCACTGTGCCTCCTACCTTGCCTGCTTCAGT

GATAGCCTGGCTGGCTTCTTTCAGAGG GTCCAGCTCCCTGAGGCCCTGCAGCAGCTCTTCCACGCCTTGAAGGAACTGCTGCTGCTCTTCTGCCATAGC

GTGCTGCTGCCCACATGGCACTTGCTGCTTGCAGCCCTGGCCCAAGTCCAGGAGCATTGCCATGAGGCCTGCAG AGGGGACGTGACCTGGGACTGCATT

AAGACACAGTTGAGCAGAGCTGCCCAATGGACCTGGCTCTGCCTGCAGGATGTCACAGTGGCTTTCTTGGACTGGGCACTCACCATGATATCCCAGCAAT

AGACCCTGCCTGCCTGGCCACTGGTTCTGTGGTGGGCTACCTATCGGAGTAGAGGAGGCAGCCCTCTTCACTTGGTGCCTGACTTCTGCCTCCTAGGCAA

GAGACCAGGTATCTGCCTCACTTCTCCATCTTCAGGAGACTGGACAGGAGCATCCCAGCCTCCTGTCCACAGGCCTGTGAGGTCTCTCAGGCCCAGTTGC

ACAGCATCCAAGCCTCTTCTAGGCTGGGAGCCTCTCCACTTCTCCCTGTGGTCCTCCCATCATCACTCAAGCAGCCACAGTCCACCTCCAAAGAAGAGAA

GTAACTGCCTTTCCTTGTCCCTGGTCATGACTTAAATCACAGCAGAGAAAAGGAAAGCACTTCAGGAGGGCCAGCACCACAGTGGGCAGCAGCAGTGTCA

CTTCTACCAGCAGCCTAGGTGACTGTCAGTGGACATGCAGGCCATGTGGACAGCCTGTTACCTCAAAACACCCAGAACAAGCACGCCTTCCCAGGAGGCC

ACTTGTCCCCTACTCTGTCAGAGCCTTGGCTTCTCAACTCCATTCTGCTCGCTGCTGGGGCTCCTCTCTATCAGCTTGGTTCACAGCACAGCCCACCTGA

AGAGCAGCGCCCTCTGTCAGCCTGCTGAAGGGGGTCAGCATATGGCTCCTGGGGAGAATAAAGACACAGACTGG
Translation
MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVLKYDLSS SPIQTTSTLYERGFEKIMKRQNKEQVPPPAAESKKPINKKQPKKVTAV

PSQNQKQGPFRRLEDALKA LDVAALQKELDKSQSVFTGNPSVWLKDLASYLNYKLQTPRMEPTLSQYPHD DYPYSLVSRELRGIIRGLLTKAAGSVEL

FFDHCLFTMLQELDKTPG GESLHGYRICIQAVLQDKPKIVTSNLDK FLELLRSHQSRPAKCLTIMWALGQAGFTNLTEGLKV VWLGIMLPVLGIKAL

SPFAIAYLDRLLL LMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLSPS SLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKE L

LASLTQCLTVDPLSTSVWRQLYPKHLSQSS SLLLEHLLKSWEHIPKK ARKSLQETIQSLKVTNQELLKKGSGGSEHVLTCDTACK - UNI11476 -

 GLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQA ASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYN NWLQETLPACGSHLLAVVQPSLQL

AWTHIYAIFSFLSAHCASYLACFSDSLAGFFQR VQLPEALQQLFHALKELLLLFCHSVLLPTWHLLLAALAQVQEHCHEACR RGDVTWDCIKTQLSRA

AQWTWLCLQDVTVAFLDWALTMISQQ

For any suggestions or comments, please send an email to unitrap@crg.es