Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038844 (Kif16b)
Chromosomal location
Chr 2: 142444081 - 142727200 (-)
Description
kinesin family member 16B Gene [Source:MGI (curated);Acc:Kif16b-001]
RefSeq_dna
NM_001081133 
RefSeq_peptide
NP_001074602.1 
UniGene
Mm.251934 Mm.417471 
MGI
MGI:1098240 
Uniprot/SPTREMBL
B1AVY7 O35056 Q3TUD2 Q8BZZ9 Q6ZPM0 
Human Ortholog
ENSG00000089177 (C20orf23)
Omim not available
UniTrap UNI8173
Vector Insertion
Chr 2: 142727060 - 142727201
Public Clones RRH147 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4821
Vector Insertion
Chr 2: 142683164 - 142688162
Public Clones AM0879 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8869
Vector Insertion
Chr 2: 142659873 - 142663252
Public Clones XM109 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2778
Vector Insertion
Chr 2: 142584646 - 142659812
Public Clones AJ0246 (sanger) AN0902 (sanger) RRR376 (baygenomics) RRQ010 (baygenomics)
RRJ572 (baygenomics) XM248 (baygenomics) IST15089D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9100
Vector Insertion
Chr 2: 142528358 - 142528410
Public Clones XK512 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32978
Vector Insertion
Chr 2: 142474163 - 142498115
Public Clones IST10845F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3945
Vector Insertion
Chr 2: 142445653 - 142474163
Public Clones AS0569 (sanger) AR1192 (sanger) AR1170 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14104
Vector Insertion
Chr 2: 142444080 - 142445653
Public Clones CMHD-GT_101D6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043589
Sequence
GGGGGCGCGGGCACGGGCACAGTCGCTGGAGTGGCCGGCGGCCGCGGGGCGCAGGCCTGTTGGAAGCCCCCGCGGGCCGGGCCGGGATGAGCTATGGCAT

CGGTCAAGGTGGCCGTGAGAGTCCGGCCCATGAATCGCAG - UNI8173 - GGAAAAGGACCTGGAGGCCAAGTTCATCATTCAAATGGAGAAAAGCA

AAACGACAATCACAAACTTAAAG ATACCAGAAGGAGGAACTGGGGATTCAGGCAGAGAACGGACCAAGACCTTCACCTATGACTTCTCTTTTTATTCTG

CTGACACCAAGAGTCCAGATTATGTCTCACAAGAAATG - UNI4821 - GTTTTCAAAACTCTGGGTACAGATGTTGTGAAATCTGCATTTGAAGGTT

ACAATGCTTGTGTCTTTGCATATGGGCAAACTGGATCTGGAAAGTCCTACACCATGATGGGAAATTCT GGCGATTCTGGCTTAATACCTCGGATCTGTG

AAGCTCTCTTCAGTCGGATCAATGAAACCACTAGATGGGATGAAGCCTCTTTCAGGACAGAAGTCAG CTACTTAGAAATTTATAATGAACGTGTGAGAG

ACCTACTTAGGCGGAAGTCATCTAAGACCTTCAATTTAAGAGTCCGTGAGCATCCCAAAGAAGGACCGTACGTTGAGG ATTTATCCAAGCATTTAGTCC

AGAACTACAGTGATGTGGAGGAACTCATGGACGCAGGAAATATCAATCGCACCACCGCAGCGACGGGGATGAATGATGTCAGTAGCAGGTCCCACGCCAT

CTTCACCATCAAGTTCACTCAG GCAAAATTCGACGCTGAAATGCCATGTGAAACTGTGAGCAAGATCCACCTCGTCGATCTTGCTGGAAGTGAGCGGGC

AGATGCCACCGGTGCCACTGGGGTCAGACTCAAGGAAGGGGGCAATATAAACAAGTCCCTTGTGACTCTGGGAAATGTCATTTCTGCCTTAG CTGATTT

ATCTCAGGATGCAGCCAACCCTCTTGTGAAGAAGAAGCAAGTTTTTGTGCCTTACAGGGATTCAGTTTTGACTTGGCTGTTGAAAGACAGCCTTGGAGGA

AACTCTAAAACCATCATGATTGCCA CCATTTCACCTGCTGATGTCAATTATGGAGAAACCCTAAGTACCCTTCGCTATGCAAATAGAGCCAAAAACATC

ATCAACAAGCCTACCATTAATGAGGATGCCAACGTCAAACTCATCCGTGAGCTGAGAGCTGAAATAGCCAGGCTGAAAACCCTGCTCGCTCAAGGGAACC

AG ATTGCCCTCTTGGACTCCCCTACAGCTTTAAGTATGGAGGAAAAACTTCACCAGAATGAAGCAAGA - UNI8869 - GTCCAAGAATTGACCAAG

GAATGGACAAACAAGTGGAATGAAACCCAGAATATTTTGAAA - UNI2778 - GAGCAAACTCTAGCCCTCAGGAAAGAGGGCATTGGTGTGGTGCTG

GACTCGGAGCTGCCGCACCTAATTGGCATTGATGATGATCTTCTGAGCACTGGAATCATCTTGTATCACTTGAAG GAGGGTCAGACTTACGTCGGCAGA

GAAGATGCTTCAACAGAGCAAGATATTG TCCTTCATGGCCTTGACTTGGAGAGTGAGCACTGTGTCTTTGAGAACGCCGGGGGAACAGTGACTCTGATA

CCCCTGAGAGGGTCCCAATGCTCTGTGAATGGTGTTCAGATTGTGGATGCCACGCAGCTAAATCAAG GTGCTGTGATACTCTTGGGAAGAACCAACATG

TTCCGCTTTAACCATCCGAAGGAAGCCGCCAAGCTTAGGGAGAAGAGGAAG AGTGGCCTCCTGTCCTCCTTCAGCTTGTCTATGACCGACCTCTCAAAG

TCCTGTGAGAACCTGTCTGCAGTCATGTTGTATAACCCTGG ACTTGAGTTTGAGAGACAACAGCGTGAAGAACTTGAAAAACTCGAAAGTAAAAG GAA

ACTCATTGAGGAGATGGAGGAAAAGCAGAAGTCGGACAAGGCAGAACTAGAGCGAATGCAGCAGGAGGTAGAGACCAGGCGCAAGGAAACAGAGATTGTG

CAGCGGCAAATCCGCAAGCAGGAGGAAAGCCTCAAACGCCGCAGCTTCCACATTGAAAACAAGCTCAAGGACCTGCTGGCTGAGAAGGAAAGGTTTGAGG

AAGAGAGGCTTCGGGAGCAGCAGGGACTCGAGCAGCAGAGGAGGCAGGAGGAAGAGAGCTTATTCCGCATCAGAGAAGAGCTTCGCAAACTCCAAGAGCT

CAACAGCCACGAACAAGCTGAGAAGGTCCAGATATTCCAGGAGCTGGACCGATTGCACCAAGAGCAAAATGCCCAGAGTGCCAAGCTGCGGTTGGAGAAA

AGGAGGCTGGAGGAGGAGGAGAAGGAGCAGGTGCAGCGGGTGGCACACCTGGAGGAGCAGCTTCGGAAGAGGCAGGACACTGCTCCTCTGCTGTGTCCTG

GAGAGGCCCAGCGGGCCCAAGAGGAAAAGAGGGAACTGGAAAGCATCCGGGAAGCCCTTTTGCAGGCCAAAGAGATGAGAGCTGGAGGGGACCATACCTG

TAGGGATGAACTGGAAAGGGCTCAGCAGTACTTCTTAGAGTTCAAGAGAAGGCAGCTTGTCAAGCTAGCAAGCCTGGAGAAGGACCTGGTCCAACAGAAA

GACCTCCTAAGCAAAGAAGTCCAAGAAGAGAAAGTAGCTCTGGAGCATGTAAAATGTGACGCAGGGGGTGACCCGAGCTTCTTGGCAACAGATGATGGCA

ACATTCTCGGTGGGCCTCCAGATCTAGACAAAATAAAGACTGCAGAGACCAGGCTACAGAGCAGAGAGCACCAGCTACAGGACCTTCTGCAAAATCATTT

GCCAGCTCTGCTGGAAGAAAAGCAGAGAGTGCTTGATGCCCTTGACAGTGGTGTCCTAGGCCTAGACACCACTCTCTGCCAAGTAGAGAAAGAAGTGGGA

GAGAAAGAAGAGCAGATCGCACAGTACCAGGCTAATGCTAGCCAGCTGCAACAGCTCCGGGCCACCTTCGAGTTCACAGCTAACGTGGCCAGACAGGAAG

AGAAGGTGAGAAGAAAGGAAAAGGAAATACTGGAGTCCCAGGAGAAACAGCAAAGAGAGGCATTGGAGCAGGCTGTGGCTAAGCTAGAGCAGAGGCGCTC

TGCCCTGCAGCGGTGCTCCACCCTGGACCTGGAGATCCAGGAGCAGAGGCAGAAACTTGGCTCTCTCCACACCAGTGAATGGTCAGGGTGGCAGGCCAGT

CTGGAGACTGATGGAGAAGCACTTGAGATGGACCCTGCAAG GTTAGAACATGAAATCCATCAGCTGAAGCAGAAGATCTGTGAAGTAGATGGTGTTCAG

AGACCTCATCATGGGATTTTAGAGGGGCAGGCCGTTCTCTCCAGCTTGCCACCCAGTGGGGGAAACTCTCACCTGGCTCCACTGATGGATGCCAG GATC

AGTGCTTACATTGAAGAAGAAGTCCAGAGACGCCTTCATGATTTGCACAGGGCAATTGGTGATGCCAACCATACACCTGCTGATGTGATGAAG - UNI9

100 - AGTAATGAGGAACTTCACAATGGCACCACTCAACGTAAGCTAAAGTATGAG - UNI9100 - CGGATGTATTCTCGCTCTTTGGGAACAAAT

CGAGACGACCTGAAGGACCCCATTAAGATTAGTATTCCTCGCTATGTCCTGTGTGGCCAAGGGAAGGACGAGCACTTCGAGTTTGAAGTGAAG - UNI3

2978 - ATTTCTGTCCTAGATGAGACATGGACTGTATTCAGGCGCTACAGTCGTTTTCGAGAAATGCATAAAACATTGAAGCTAAAGTATGCAGAG - 

UNI32978 - CTCGCTGCTCTTGAATTCCCCCCAAAGAAGCTGTTTGGAAACAAAGACGAGCGGGTAGTTGCTGAGCGGCGGACACACTTAGAG - UN

I3945 - - UNI14104 - - UNI32978 - AAATACCTCAGGGAGTTTTTCAGTGTGATGCTCCAGTCCGAGACATCTCCCCTTCACATCAACAAA

GTGGGACTGACCCTGTCCAAGCACACCATTTGTGAATTCTCACCATTCTTCAAGAAAGGAGTTTTTGACTACAGCAGCCATGGGACAGGGTAGAGCTGTG

GCGACCAAGGAACCACCAACACAGTGCCTTCTCATCAAATAGACTCTGATGCAGAGTGGACTCCTGCACCAGGATTCCAGCTTGCCTCCTCCAGTTGTGG

CAACATGCAGCAGCCAGCCCAGACCACCTCTCACACCATATCTAGTGCCTGAGTTTGGGAGTGGGTGCTTGCCTGCCAAGGGCAACTCTGATTGACAGTT

GTTACTGTACCTCTGCACTTGAACGTGGCCTTTCCCATAGTACAGCAAGTCAATCCCCTGTGGCAGGATGGATGTGTGGCTTGCTTATCTAGGGACTCCT

AGAGCCAAGCCAACTTGGGACTTCCCATTGTGGGTGGCTTACCAGACCACCCTTAAGTGACTTTCATCTGGTTTCCTTTTTCACCAAAATATGCTTTTTT

TTTTATACTTCTTCCATGTGGCTGGCTAGGTTTCAAAGATGTTTTAAGTTATGTCATATTGTTTTGTTCATTTGGATTTGGATTTAATAATATCTAAATA

CTGACGTTTACATAGAATGTCCTGTTCAGTAAAAAGGATCTGTAGGCCAATCATGAGAAGAGTCTTCCATGCCTGACAAATTGGATGTAGGCAACATTGC

AGAAACTTGCAGAAATCCCTACAAATAAGACATTGTTTAACCTTCACTATTTGAGGGCATTTTCCCAAACCTCAAAGGCTGTTGTTCATTTTTTAGCTTT

TTCTGCATAAAACAAGTGCAAAGCTGGATGCAATCTTTTAAATATCCTTTGTCCATGTTTTAGTACAGAACCTTCAAGATCATTAACTAAAAAGAGAGAG

AGAATTTTCAGTAGTTTATTAATAATCCCTCAATTACTCAGGACATAATGTAGCATTTCACATCGTGTACAGTGAAACTGCTTCCTTTATCAAAAGAAAA

TTGTGAGTAGGAAAAATCTGTGGTATATATTGAAATGTACATAATTCAACATATAGATTTATATGTATACACTCCTGTACAATAGTATATCAGGCTATAT

GATCATTCACACCAAATTTATTAAAGGTGTTTGCTTTTTCAACTGTTAAATTGAGCTGCTATCAATATTAAATGAAGTCATGTGCTATACCCTGTAGTTC

AGTTTAAGTTTGTAATATGATCATTTCTACTGGTCTGTTTAACAATTGACCTGATATGCTTAGAAAGAGGCATATTGTACAATTTAGCATTTATGTTGCA

GAAAATGCAGTTATGATTGAAGTCACAAATGAATGGATAACAAAACATGCTTGCATTCAGTCTTCTAGAACATGCCCGCACAGCAGATCTCTCCAAGCTC

ACAAGAATGTTGGAAGATGCAGCTAGCCCTATAAGGAGGAGACTAATATTCAATTAATTAAATATCATAGCTTAGCATGAAAAAATAAAACGGACTCTTT

ATTTAA
Translation
MASVKVAVRVRPMNRR - UNI8173 - REKDLEAKFIIQMEKSKTTITNLK IPEGGTGDSGRERTKTFTYDFSFYSADTKSPDYVSQEM - UNI48

21 - VFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNS GDSGLIPRICEALFSRINETTRWDEASFRTEVS SYLEIYNERVRDLLRRKSSKT

FNLRVREHPKEGPYVED DLSKHLVQNYSDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQ AKFDAEMPCETVSKIHLVDLAGSERADATGATG

VRLKEGGNINKSLVTLGNVISALA ADLSQDAANPLVKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIAT TISPADVNYGETLSTLRYANRAKNIINKP

TINEDANVKLIRELRAEIARLKTLLAQGNQ IALLDSPTALSMEEKLHQNEAR - UNI8869 - VQELTKEWTNKWNETQNILK - UNI2778 - E

QTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLK EGQTYVGREDASTEQDIV VLHGLDLESEHCVFENAGGTVTLIPLRGSQCSVNGVQIVDA

TQLNQG GAVILLGRTNMFRFNHPKEAAKLREKRK SGLLSSFSLSMTDLSKSCENLSAVMLYNPG GLEFERQQREELEKLESKR RKLIEEMEEKQKS

DKAELERMQQEVETRRKETEIVQRQIRKQEESLKRRSFHIENKLKDLLAEKERFEEERLREQQGLEQQRRQEEESLFRIREELRKLQELNSHEQAEKVQI

FQELDRLHQEQNAQSAKLRLEKRRLEEEEKEQVQRVAHLEEQLRKRQDTAPLLCPGEAQRAQEEKRELESIREALLQAKEMRAGGDHTCRDELERAQQYF

LEFKRRQLVKLASLEKDLVQQKDLLSKEVQEEKVALEHVKCDAGGDPSFLATDDGNILGGPPDLDKIKTAETRLQSREHQLQDLLQNHLPALLEEKQRVL

DALDSGVLGLDTTLCQVEKEVGEKEEQIAQYQANASQLQQLRATFEFTANVARQEEKVRRKEKEILESQEKQQREALEQAVAKLEQRRSALQRCSTLDLE

IQEQRQKLGSLHTSEWSGWQASLETDGEALEMDPAR RLEHEIHQLKQKICEVDGVQRPHHGILEGQAVLSSLPPSGGNSHLAPLMDAR RISAYIEEEV

QRRLHDLHRAIGDANHTPADVMK - UNI9100 - SNEELHNGTTQRKLKYE - UNI9100 - RMYSRSLGTNRDDLKDPIKISIPRYVLCGQGKDE

HFEFEVK - UNI32978 - ISVLDETWTVFRRYSRFREMHKTLKLKYAE - UNI32978 - LAALEFPPKKLFGNKDERVVAERRTHLE - UNI3

945 - - UNI14104 - - UNI32978 - KYLREFFSVMLQSETSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG
Transcript ENSMUST00000077077
Sequence
GGGGGCGCGGGCACGGGCACAGTCGCTGGAGTGGCCGGCGGCCGCGGGGCGCAGGCCTGTTGGAAGCCCCCGCGGGCCGGGCCGGGATGAGCTATGGCAT

CGGTCAAGGTGGCCGTGAGAGTCCGGCCCATGAATCGCAG - UNI8173 - GGAAAAGGACCTGGAGGCCAAGTTCATCATTCAAATGGAGAAAAGCA

AAACGACAATCACAAACTTAAAG ATACCAGAAGGAGGAACTGGGGATTCAGGCAGAGAACGGACCAAGACCTTCACCTATGACTTCTCTTTTTATTCTG

CTGACACCAAGAGTCCAGATTATGTCTCACAAGAAATG - UNI4821 - GTTTTCAAAACTCTGGGTACAGATGTTGTGAAATCTGCATTTGAAGGTT

ACAATGCTTGTGTCTTTGCATATGGGCAAACTGGATCTGGAAAGTCCTACACCATGATGGGAAATTCT GGCGATTCTGGCTTAATACCTCGGATCTGTG

AAGCTCTCTTCAGTCGGATCAATGAAACCACTAGATGGGATGAAGCCTCTTTCAGGACAGAAGTCAG CTACTTAGAAATTTATAATGAACGTGTGAGAG

ACCTACTTAGGCGGAAGTCATCTAAGACCTTCAATTTAAGAGTCCGTGAGCATCCCAAAGAAGGACCGTACGTTGAGG ATTTATCCAAGCATTTAGTCC

AGAACTACAGTGATGTGGAGGAACTCATGGACGCAGGAAATATCAATCGCACCACCGCAGCGACGGGGATGAATGATGTCAGTAGCAGGTCCCACGCCAT

CTTCACCATCAAGTTCACTCAG GCAAAATTCGACGCTGAAATGCCATGTGAAACTGTGAGCAAGATCCACCTCGTCGATCTTGCTGGAAGTGAGCGGGC

AGATGCCACCGGTGCCACTGGGGTCAGACTCAAGGAAGGGGGCAATATAAACAAGTCCCTTGTGACTCTGGGAAATGTCATTTCTGCCTTAG CTGATTT

ATCTCAGGATGCAGCCAACCCTCTTGTGAAGAAGAAGCAAGTTTTTGTGCCTTACAGGGATTCAGTTTTGACTTGGCTGTTGAAAGACAGCCTTGGAGGA

AACTCTAAAACCATCATGATTGCCA CCATTTCACCTGCTGATGTCAATTATGGAGAAACCCTAAGTACCCTTCGCTATGCAAATAGAGCCAAAAACATC

ATCAACAAGCCTACCATTAATGAGGATGCCAACGTCAAACTCATCCGTGAGCTGAGAGCTGAAATAGCCAGGCTGAAAACCCTGCTCGCTCAAGGGAACC

AG ATTGCCCTCTTGGACTCCCCTACAGCTTTAAGTATGGAGGAAAAACTTCACCAGAATGAAGCAAGA - UNI8869 - GTCCAAGAATTGACCAAG

GAATGGACAAACAAGTGGAATGAAACCCAGAATATTTTGAAA - UNI2778 - GAGCAAACTCTAGCCCTCAGGAAAGAGGGCATTGGTGTGGTGCTG

GACTCGGAGCTGCCGCACCTAATTGGCATTGATGATGATCTTCTGAGCACTGGAATCATCTTGTATCACTTGAAG GAGGGTCAGACTTACGTCGGCAGA

GAAGATGCTTCAACAGAGCAAGATATTG TCCTTCATGGCCTTGACTTGGAGAGTGAGCACTGTGTCTTTGAGAACGCCGGGGGAACAGTGACTCTGATA

CCCCTGAGAGGGTCCCAATGCTCTGTGAATGGTGTTCAGATTGTGGATGCCACGCAGCTAAATCAAG GTGCTGTGATACTCTTGGGAAGAACCAACATG

TTCCGCTTTAACCATCCGAAGGAAGCCGCCAAGCTTAGGGAGAAGAGGAAG AGTGGCCTCCTGTCCTCCTTCAGCTTGTCTATGACCGACCTCTCAAAG

TCCTGTGAGAACCTGTCTGCAGTCATGTTGTATAACCCTGG ACTTGAGTTTGAGAGACAACAGCGTGAAGAACTTGAAAAACTCGAAAGTAAAAG GAA

ACTCATTGAGGAGATGGAGGAAAAGCAGAAGTCGGACAAGGCAGAACTAGAGCGAATGCAGCAGGAGGTAGAGACCAGGCGCAAGGAAACAGAGATTGTG

CAGCGGCAAATCCGCAAGCAGGAGGAAAGCCTCAAACGCCGCAGCTTCCACATTGAAAACAAGCTCAAGGACCTGCTGGCTGAGAAGGAAAGGTTTGAGG

AAGAGAGGCTTCGGGAGCAGCAGGGACTCGAGCAGCAGAGGAGGCAGGAGGAAGAGAGCTTATTCCGCATCAGAGAAGAGCTTCGCAAACTCCAAGAGCT

CAACAGCCACGAACAAGCTGAGAAGGTCCAGATATTCCAGGAGCTGGACCGATTGCACCAAGAGCAAAATGCCCAGAGTGCCAAGCTGCGGTTGGAGAAA

AGGAGGCTGGAGGAGGAGGAGAAGGAGCAGGTGCAGCGGGTGGCACACCTGGAGGAGCAGCTTCGGAAGAGGCAGGACACTGCTCCTCTGCTGTGTCCTG

GAGAGGCCCAGCGGGCCCAAGAGGAAAAGAGGGAACTGGAAAGCATCCGGGAAGCCCTTTTGCAGGCCAAAGAGATGAGAGCTGGAGGGGACCATACCTG

TAGGGATGAACTGGAAAGGGCTCAGCAGTACTTCTTAGAGTTCAAGAGAAGGCAGCTTGTCAAGCTAGCAAGCCTGGAGAAGGACCTGGTCCAACAGAAA

GACCTCCTAAGCAAAGAAGTCCAAGAAGAGAAAGTAGCTCTGGAGCATGTAAAATGTGACGCAGGGGGTGACCCGAGCTTCTTGGCAACAGATGATGGCA

ACATTCTCGGTGGGCCTCCAGATCTAGACAAAATAAAGACTGCAGAGACCAGG AGAAGAAAGGAAAAGGAAATACTGGAGTCCCAGGAGAAACAGCAAA

GAGAGGCATTGGAGCAGGCTGTGGCTAAGCTAGAGCAGAGGCGCTCTGCCCTGCAGCGGTGCTCCACCCTGGACCTGGAGATCCAGGAGCAGAGGCAGAA

ACTTGGCTCTCTCCACACCAGTGAATGGTCAGGGTGGCAGGCCAGTCTGGAGACTGATGGAGAAGCACTTGAGATGGACCCTGCAAG GTTAGAACATGA

AATCCATCAGCTGAAGCAGAAGATCTGTGAAGTAGATGGTGTTCAGAGACCTCATCATGGGATTTTAGAGGGGCAGGCCGTTCTCTCCAGCTTGCCACCC

AGTGGGGGAAACTCTCACCTGGCTCCACTGATGGATGCCAG GATCAGTGCTTACATTGAAGAAGAAGTCCAGAGACGCCTTCATGATTTGCACAGGGCA

ATTGGTGATGCCAACCATACACCTGCTGATGTGATGAAG - UNI9100 - AGTAATGAGGAACTTCACAATGGCACCACTCAACGTAAGCTAAAGTAT

GAG - UNI9100 - CGGATGTATTCTCGCTCTTTGGGAACAAATCGAGACGACCTGAAGGACCCCATTAAGATTAGTATTCCTCGCTATGTCCTGTGT

GGCCAAGGGAAGGACGAGCACTTCGAGTTTGAAGTGAAG - UNI32978 - ATTTCTGTCCTAGATGAGACATGGACTGTATTCAGGCGCTACAGTCG

TTTTCGAGAAATGCATAAAACATTGAAGCTAAAGTATGCAGAG - UNI32978 - CTCGCTGCTCTTGAATTCCCCCCAAAGAAGCTGTTTGGAAACA

AAGACGAGCGGGTAGTTGCTGAGCGGCGGACACACTTAGAG - UNI3945 - - UNI14104 - - UNI32978 - AAATACCTCAGGGAGTTTTT

CAGTGTGATGCTCCAGTCCGAGACATCTCCCCTTCACATCAACAAAGTGGGACTGACCCTGTCCAAGCACACCATTTGTGAATTCTCACCATTCTTCAAG

AAAGGAGTTTTTGACTACAGCAGCCATGGGACAGGGTAGAGCTGTGGCGACCAAGGAACCACCAACACAGTGCCTTCTCATCAAATAGACTCTGATGCAG

AGTGGACTCCTGCACCAGGATTCCAGCTTGCCTCCTCCAGTTGTGGCAACATGCAGCAGCCAGCCCAGACCACCTCTCACACCATATCTAGTGCCTGAGT

TTGGGAGTGGGTGCTTGCCTGCCAAGGGCAACTCTGATTGACAGTTGTTACTGTACCTCTGCACTTGAACGTGGCCTTTCCCATAGTACAGCAAGTCAAT

CCCCTGTGGCAGGATGGATGTGTGGCTTGCTTATCTAGGGACTCCTAGAGCCAAGCCAACTTGGGACTTCCCATTGTGGGTGGCTTACCAGACCACCCTT

AAGTGACTTTCATCTGGTTTCCTTTTTCACCAAAATATGCTTTTTTTTTTATACTTCTTCCATGTGGCTGGCTAGGTTTCAAAGATGTTTTAAGTTATGT

CATATTGTTTTGTTCATTTGGATTTGGATTTAATAATATCTAAATACTGACGTTTACATAGAATGTCCTGTTCAGTAAAAAGGATCTGTAGGCCAATCAT

GAGAAGAGTCTTCCATGCCTGACAAATTGGATGTAGGCAACATTGCAGAAACTTGCAGAAATCCCTACAAATAAGACATTGTTTAACCTTCACTATTTGA

GGGCATTTTCCCAAACCTCAAAGGCTGTTGTTCATTTTTTAGCTTTTTCTGCATAAAACAAGTGCAAAGCTGGATGCAATCTTTTAAATATCCTTTGTCC

ATGTTTTAGTACAGAACCTTCAAGATCATTAACTAAAAAGAGAGAGAGAATTTTCAGTAGTTTATTAATAATCCCTCAATTACTCAGGACATAATGTAGC

ATTTCACATCGTGTACAGTGAAACTGCTTCCTTTATCAAAAGAAAATTGTGAGTAGGAAAAATCTGTGGTATATATTGAAATGTACATAATTCAACATAT

AGATTTATATGTATACACTCCTGTACAATAGTATATCAGGCTATATGATCATTCACACCAAATTTATTAAAGGTGTTTGCTTTTTCAACTGTTAAATTGA

GCTGCTATCAATATTAAATGAAGTCATGTGCTATACCCTGTAGTTCAGTTTAAGTTTGTAATATGATCATTTCTACTGGTCTGTTTAACAATTGACCTGA

TATGCTTAGAAAGAGGCATATTGTACAATTTAGCATTTATGTTGCAGAAAATGCAGTTATGATTGAAGTCACAAATGAATGGATAACAAAACATGCTTGC

ATTCAGTCTTCTAGAACATGCCCGCACAGCAGATCTCTCCAAGCTCACAAGAATGTTGGAAGATGCAGCTAGCCCTATAAGGAGGAGACTAATATTCAAT

TAATTAAATATCATAGCTTAGCATGAAAAAATAAAACGGACTCTTTATTTAA
Translation
 - UNI8173 -   - UNI4821 -        MEEKLHQNEAR - UNI8869 - VQELTKEWTNKWNETQNILK - UNI2778 - EQTLALRKE

GIGVVLDSELPHLIGIDDDLLSTGIILYHLK EGQTYVGREDASTEQDIV VLHGLDLESEHCVFENAGGTVTLIPLRGSQCSVNGVQIVDATQLNQG G

AVILLGRTNMFRFNHPKEAAKLREKRK SGLLSSFSLSMTDLSKSCENLSAVMLYNPG GLEFERQQREELEKLESKR RKLIEEMEEKQKSDKAELERM

QQEVETRRKETEIVQRQIRKQEESLKRRSFHIENKLKDLLAEKERFEEERLREQQGLEQQRRQEEESLFRIREELRKLQELNSHEQAEKVQIFQELDRLH

QEQNAQSAKLRLEKRRLEEEEKEQVQRVAHLEEQLRKRQDTAPLLCPGEAQRAQEEKRELESIREALLQAKEMRAGGDHTCRDELERAQQYFLEFKRRQL

VKLASLEKDLVQQKDLLSKEVQEEKVALEHVKCDAGGDPSFLATDDGNILGGPPDLDKIKTAETR RRKEKEILESQEKQQREALEQAVAKLEQRRSALQ

RCSTLDLEIQEQRQKLGSLHTSEWSGWQASLETDGEALEMDPAR RLEHEIHQLKQKICEVDGVQRPHHGILEGQAVLSSLPPSGGNSHLAPLMDAR RI

SAYIEEEVQRRLHDLHRAIGDANHTPADVMK - UNI9100 - SNEELHNGTTQRKLKYE - UNI9100 -  - UNI32978 -  - UNI32978 

-  - UNI3945 - - UNI14104 - - UNI32978 - 

For any suggestions or comments, please send an email to unitrap@crg.es