Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038909 (Myst2)
Chromosomal location
Chr 11: 95135573 - 95171515 (-)
Description
MYST histone acetyltransferase 2 Gene [Source:MGI (curated);Acc:Myst2-002]
RefSeq_dna
NM_177619 
RefSeq_peptide
NP_808287.1 
UniGene
Mm.408700 Mm.472268 
MGI
MGI:2182799 
Uniprot/SWISSPROT
Q5SVQ0 
Uniprot/SPTREMBL
Q1AJD0 Q3UGF2 Q3UGU8 Q3TD41 
Human Ortholog
ENSG00000136504 (MYST2)
Omim not available
UniTrap UNI2477
Vector Insertion
Chr 11: 95170917 - 95171348
Public Clones XT0652 (sanger) XA298 (baygenomics) CSH628 (baygenomics) XH886 (baygenomics)
RRR335 (baygenomics) P090E01 (ggtc) IST10122A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17568
Vector Insertion
Chr 11: 95167511 - 95170850
Public Clones (sanger) P106H03 (ggtc) D163D06 (ggtc) E138C03 (ggtc) D092D11 (ggtc)
P135A09 (ggtc) E039B07 (ggtc) P099D03 (ggtc) D093B11 (ggtc) E087H02 (ggtc)
D035C12 (ggtc) P133F06 (ggtc) D188C09 (ggtc) E138C04 (ggtc) P142E04 (ggtc)
CMHD-GT_506E11-3 (cmhd) PST19053-NL (escells) IST14464E3 (tigm) IST14419B4 (tigm)
IST14884A6 (tigm)
Private Clones OST440612 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22
Vector Insertion
Chr 11: 95164624 - 95167362
Public Clones GC0311 (tigem) GC0263 (tigem) (sanger) CSH205 (baygenomics) HMA086 (baygenomics)
CSI633 (baygenomics) A049F04 (ggtc) PST10105-NR (escells) PST9404-NR (escells)
PST6468-NR (escells) IST13659G7 (tigm)
Private Clones OST145694 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5647
Vector Insertion
Chr 11: 95161533 - 95164446
Public Clones (sanger) CSH200 (baygenomics) CSI646 (baygenomics) HMA367 (baygenomics)
CSI647 (baygenomics) CSI738 (baygenomics) W031F03 (ggtc) PST11307-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5671
Vector Insertion
Chr 11: 95155960 - 95161292
Public Clones XJ101 (baygenomics) XC316 (baygenomics) CSI661 (baygenomics) F052A06 (ggtc)
PST4534-NR (escells) PST1217 (escells) PST12482-NR (escells) PST15020-NR (escells)
PST1309 (escells) PST2433-NR (escells) PST11963-NR (escells) PST11963-NL (escells)
PST2885-NR (escells) PST12581-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37495
Vector Insertion
Chr 11: 95145342 - 95147755
Public Clones PST18207-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107734
Sequence
GAAGGCTCTAGACGCTGAGAGGTAGGAGGCACTTGGGATCGTCCGCAGGGTTTGGGACAGCTACAGAGGCCGCCACGGAGCCCGCCGGAGCCCCCGTTCC

TGCTGGTGCTGCCGCCGCCCGAATCGGAACCGTCGGGCTGCAGCCGCCGGCAATGCCGCGAAGGAAG - UNI2477 - - UNI17568 - AGAAATG

CAGGCAGTAGTTCAGATGGAACCGAAGATTCCGATTTTTCTACAGATCTCGAGCATACAGACAGTTCAGAGAGTGATGGCACCTCGCGCCGATCTGCCCG

AGTCACCCGCTCCTCAGCCAGGCTAAGCCAGAGTTCCCAAG - UNI22 - ATTCCAGCCCTGTTCGAAATTTGCCGTCTTTCGGCACTGAGGAGCCTG

CCTATTCTACCAGAAGGGTGACCCGTAGTCAGCAGCAGCCCACGCCAGTGACTCCAAAAAAGTACCCTCTTCGACAGACTCGCTCATCTGGCTCTGAAAC

GGAGCAGGTGGTGGACTTTTCAGATAGAG - UNI5647 - AAACTAAAAATACAGCTGATCATGATGAGTCACCACCTCGAACTCCAACCGGAAATGC

ACCTTCTTCTGAGTCTGACATAGACATCTCCAGCCCCAACGTGTCTCATGATGAGAGCATTGCCAAGGACATGTCCCTGAAGGACTCAGGCAGTGATCTC

TCTCACCGTCCCAAGCGACGTCGATTTCACGAAAGCTACAATTTCAACATGAAGTGTCCTACGCCGGGCTGCAACTCTCTAG - UNI5671 - GACAT

CTTACAGGAAAGCACGAGAGACATTTCTCCATCTCAGGATGCCCGCTGTATCATAACCTCTCAGCTGACGAATGCAAG GTGAGAGCACAGAGCCGGGAT

AAGCAGATAGAAGAAAGGATGCTGTCCCACAGGCAAGATGACAACAACAGGCATGCAACCAGGCACCAG GCACCAACAGAGAGACAGCTGCGGTATAAG

GAAAAGGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAGCAGAAGGAGAAATACATG - UNI37495 - GAACACAGACAGACCTA

TGGGAACACTCGGGAGCCTCTCTTGGAAAACCTGACAAGTGAATATGACTTAGATCTTTTCCGAAGAGCACAAGCCCGGGCTTCTGAGGATTTG - UNI

37495 - GAGAAGTTAAGGCTTCAAGGCCAAATCACAGAGGGAAGCAACATGATTAAAACAATTGCTTTTGGCCGCTATGAACTGGACACTTGGTACCA

CTCTCCCTATCCTGAGGAATATGCGAGGCTGGGACGTCTCTACATGTGTGAATTCTGCTTAAAGTACATGAAGAGCCAGACAATCCTCCGCCGACACATG

 - UNI37495 - GCCAAGTGTGTGTGGAAACACCCCCCTGGTGATGAGATTTATCGCAAAGGCTCCATCTCTGTGTTTGAAGTAGACGGCAAGAAGAA

CAAG ATCTACTGCCAAAACCTCTGCCTTTTGGCAAAGCTTTTTCTGGACCATAAGACGCTATACTATGATGTAGAACCTTTCCTGTTCTACGTTATGAC

AGAAGCGGACAATACTGGCTGTCATCTGATTGGATATTTTTCTAAG GAGAAGAATTCATTTCTCAACTATAATGTCTCGTGCATCCTCACCATGCCTCA

GTACATGCGACAGGGCTACGGGAAGATGCTGATCGATTTCA GTTATTTACTTTCCAAAGTAGAAGAGAAAGTCGGCTCTCCAGAGCGCCCACTGTCAGA

CCTGGGGCTCATAAGCTACCGCAGCTACTGGAAGGAGGTACTGCTCCGATACCTGCACAACTTCCAGGGCAAGGAGATCTCCATCAAAG AAATTAGCCA

GGAAACAGCTGTGAATCCCGTGGACATTGTCAGCACTCTGCAAGCCCTTCAGATGCTCAAGTATTGGAAAGGCAAGCACCTAGTTTTAAAGAGACAG GA

CCTGATAGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAACAAAACCATGGATCCAAGCTGCTTAAAATGGACCCCTCCCAAGGGCACTTAA

AGTGACCTATCATTCCGAGCCAGCGAGCCCCAGCAGTAGGAATCCGTACCCTAGGGATCTGTCTGTCATTTCTGTTGCTCTTGTGATTGGCAAGTACAGT

ATCCTTTGGGAAGGCCACCCCCTCAGCACTGTTCTGGCTCCAGCCTTCGTGTACACTGCAGACACTAGTTCTGAGGAACTGTTGTTTCGGCCTCAGTGAG

GTTGCCTGGACGGATCTGTATGAGGCTCGAGTACAGATCCCTCATAGCACTGACCCAAGGAGTTGTGTTATGGTACTGTACCTGTCCAGTCACTGGTTCC

CACCTCATGCTTTTTAACTCCGAGGTTTGTTGTGTCCTGACCTTTGTGCTAGTGCTTTTTCCTGCCTGGATAGCAGACCTCCAAACATGGTTGCCACCAA

AGGGCCCTTTCCAGTTACTTCTAACACATTCTTCATGAAGGGGTGGGCAAGAGGCAGCGCCTGTGCGTGTCTGCTGGGAGGGTCCGCTCACCATGGGTTT

CATCTCGCAGTCACTCATTTTTCTCCCTTTTTGTCAAAAGACTTACTACCTTTGATCAGGATCAGGCTGCCCAGAGCTAGGAACGCCTGGCATTTCCCAG

GGGTTCACAGGCCTGGTCCATCTGCGTGAGATGGTGAAGCCTAAGAGGTGGTCCCATGCTTTCCTTTGTATTTACTTGTGGACACTGGGGCAGCATTGTG

TAGAAGGAAATGAGGAATTCTTTGCCACAGCAGAAAATGCCCCCACTTTTTTTTCTGCCCCCTTTTATGTTGGTAGTTGCCAAAATATTTTAACAGTCTT

TTTTCATACATTAAATGACCACCCTGTGGATCTTTCCACACCTGCCTCTGCCAGTCTGGTGTAGGGCAGCTCTACTTTCCACACAAGTTGCACTGATCTT

GTCCAGAGCTTCCTGGGAGAAGTGGAAACTGGTTGAAATGCTTGTGTTTCTCAGCCCATGACTCAGCAAGACAGGGTGGCCACTCTGCTACGGTTTGCTT

CGCTCTCAACAGTGCCTCCCTCCCCCAGCAGACTGAAGTGCTTCTGTCTAAGAACTAAGTCCATTCCCTTTCGGGACTTGCCACCATCATCCTGTTCTCT

GGGTTCCTATTTTTGGTGGTGTTAAGTGAAGGAAGAAGTGTTCCCTCTAATTTCTCCCTGTCCCAGTATATAACCTGCTATCTTGGGGCAGCTTTTGATG

TCTGACATGTCACCCTTCCCAAGTTGGTCTCTTCCAACACTGCTGTCTTCACGTGGCACCCTCTTACCACAACCCTAACTCTGGTCATTTGTGCCTTTCT

CTTGTCATCTCTGTACACTACTAATATTCACTGTGGGTTGGGGAGCTGATTTTAAGCATGTTCAGTGGCTCCCCTCCAGTTTCAGTGTAACTGTTAAAAT

GTATCCAAAAGCCACTTCACTGGGGGTTTTCTTAAGGGGTAAAGGCCTTTTACAGATGCTGAGCCCTCCCCACATGTGGCAGAATGTGCTCTTCTGTATC

TACTCAATAAAGCATGTTCTCTGCTC
Translation
MPRRK - UNI2477 - - UNI17568 - RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQD - UNI22 - DSSPVRNL

PSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRE - UNI5647 - ETKNTADHDESPPRTPTGNAPSSESDIDISSPNVS

HDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLG - UNI5671 - GHLTGKHERHFSISGCPLYHNLSADECK VRAQSRDKQIEE

RMLSHRQDDNNRHATRHQ APTERQLRYKEKVAELRKKRNSGLSKEQKEKYM - UNI37495 - EHRQTYGNTREPLLENLTSEYDLDLFRRAQARAS

EDL - UNI37495 - EKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM - UNI37495 - AKCVW

KHPPGDEIYRKGSISVFEVDGKKNK IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK EKNSFLNYNVSCILTMPQYMRQGYGK

MLIDFS SYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKE EISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQ DLIDE

WIAKEAKRSNSNKTMDPSCLKWTPPKGT
Transcript ENSMUST00000107733
Sequence
GAAGGCTCTAGACGCTGAGAGGTAGGAGGCACTTGGGATCGTCCGCAGGGTTTGGGACAGCTACAGAGGCCGCCACGGAGCCCGCCGGAGCCCCCGTTCC

TGCTGGTGCTGCCGCCGCCCGAATCGGAACCGTCGGGCTGCAGCCGCCGGCAATGCCGCGAAGGAAG - UNI2477 - - UNI17568 - AGAAATG

CAGGCAGTAGTTCAGATGGAACCGAAGATTCCGATTTTTCTACAGATCTCGAGCATACAGACAGTTCAGAGAGTGATGGCACCTCGCGCCGATCTGCCCG

AGTCACCCGCTCCTCAGCCAGGCTAAGCCAGAGTTCCCAAG - UNI22 - ATTCCAGCCCTGTTCGAAATTTGCCGTCTTTCGGCACTGAGGAGCCTG

CCTATTCTACCAGAAGGGTGACCCGTAGTCAGCAGCAGCCCACGCCAGTGACTCCAAAAAAGTACCCTCTTCGACAGACTCGCTCATCTGGCTCTGAAAC

GGAGCAGGTGGTGGACTTTTCAGATAGAG - UNI5647 - AAACTAAAAATACAGCTGATCATGATGAGTCACCACCTCGAACTCCAACCGGAAATGC

ACCTTCTTCTGAGTCTGACATAGACATCTCCAGCCCCAACGTGTCTCATGATGAGAGCATTGCCAAGGACATGTCCCTGAAGGACTCAGGCAGTGATCTC

TCTCACCGTCCCAAGCGACGTCGATTTCACGAAAGCTACAATTTCAACATGAAGTGTCCTACGCCGGGCTGCAACTCTCTAG - UNI5671 - GACAT

CTTACAGGAAAGCACGAGAGACATTTCTCCATCTCAGGATGCCCGCTGTATCATAACCTCTCAGCTGACGAATGCAAG GCACCAACAGAGAGACAGCTG

CGGTATAAGGAAAAGGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAGCAGAAGGAGAAATACATG - UNI37495 - GAACACAG

ACAGACCTATGGGAACACTCGGGAGCCTCTCTTGGAAAACCTGACAAGTGAATATGACTTAGATCTTTTCCGAAGAGCACAAGCCCGGGCTTCTGAGGAT

TTG - UNI37495 - GAGAAGTTAAGGCTTCAAGGCCAAATCACAGAGGGAAGCAACATGATTAAAACAATTGCTTTTGGCCGCTATGAACTGGACAC

TTGGTACCACTCTCCCTATCCTGAGGAATATGCGAGGCTGGGACGTCTCTACATGTGTGAATTCTGCTTAAAGTACATGAAGAGCCAGACAATCCTCCGC

CGACACATG - UNI37495 - GCCAAGTGTGTGTGGAAACACCCCCCTGGTGATGAGATTTATCGCAAAGGCTCCATCTCTGTGTTTGAAGTAGACGG

CAAGAAGAACAAG ATCTACTGCCAAAACCTCTGCCTTTTGGCAAAGCTTTTTCTGGACCATAAGACGCTATACTATGATGTAGAACCTTTCCTGTTCTA

CGTTATGACAGAAGCGGACAATACTGGCTGTCATCTGATTGGATATTTTTCTAAG GAGAAGAATTCATTTCTCAACTATAATGTCTCGTGCATCCTCAC

CATGCCTCAGTACATGCGACAGGGCTACGGGAAGATGCTGATCGATTTCA GTTATTTACTTTCCAAAGTAGAAGAGAAAGTCGGCTCTCCAGAGCGCCC

ACTGTCAGACCTGGGGCTCATAAGCTACCGCAGCTACTGGAAGGAGGTACTGCTCCGATACCTGCACAACTTCCAGGGCAAGGAGATCTCCATCAAAG A

AATTAGCCAGGAAACAGCTGTGAATCCCGTGGACATTGTCAGCACTCTGCAAGCCCTTCAGATGCTCAAGTATTGGAAAGGCAAGCACCTAGTTTTAAAG

AGACAG GACCTGATAGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAACAAAACCATGGATCCAAGCTGCTTAAAATGGACCCCTCCCAAG

GGCACTTAAAGTGACCTATCATTCCGAGCCAGCGAGCCCCAGCAGTAGGAATCCGTACCCTAGGGATCTGTCTGTCATTTCTGTTGCTCTTGTGATTGGC

AAGTACAGTATCCTTTGGGAAGGCCACCCCCTCAGCACTGTTCTGGCTCCAGCCTTCGTGTACACTGCAGACACTAGTTCTGAGGAACTGTTGTTTCGGC

CTCAGTGAGGTTGCCTGGACGGATCTGTATGAGGCTCGAGTACAGATCCCTCATAGCACTGACCCAAGGAGTTGTGTTATGGTACTGTACCTGTCCAGTC

ACTGGTTCCCACCTCATGCTTTTTAACTCCGAGGTTTGTTGTGTCCTGACCTTTGTGCTAGTGCTTTTTCCTGCCTGGATAGCAGACCTCCAAACATGGT

TGCCACCAAAGGGCCCTTTCCAGTTACTTCTAACACATTCTTCATGAAGGGGTGGGCAAGAGGCAGCGCCTGTGCGTGTCTGCTGGGAGGGTCCGCTCAC

CATGGGTTTCATCTCGCAGTCACTCATTTTTCTCCCTTTTTGTCAAAAGACTTACTACCTTTGATCAGGATCAGGCTGCCCAGAGCTAGGAACGCCTGGC

ATTTCCCAGGGGTTCACAGGCCTGGTCCATCTGCGTGAGATGGTGAAGCCTAAGAGGTGGTCCCATGCTTTCCTTTGTATTTACTTGTGGACACTGGGGC

AGCATTGTGTAGAAGGAAATGAGGAATTCTTTGCCACAGCAGAAAATGCCCCCACTTTTTTTTCTGCCCCCTTTTATGTTGGTAGTTGCCAAAATATTTT

AACAGTCTTTTTTCATACATTAAATGACCACCCTGTGGATCTTTCCACACCTGCCTCTGCCAGTCTGGTGTAGGGCAGCTCTACTTTCCACACAAGTTGC

ACTGATCTTGTCCAGAGCTTCCTGGGAGAAGTGGAAACTGGTTGAAATGCTTGTGTTTCTCAGCCCATGACTCAGCAAGACAGGGTGGCCACTCTGCTAC

GGTTTGCTTCGCTCTCAACAGTGCCTCCCTCCCCCAGCAGACTGAAGTGCTTCTGTCTAAGAACTAAGTCCATTCCCTTTCGGGACTTGCCACCATCATC

CTGTTCTCTGGGTTCCTATTTTTGGTGGTGTTAAGTGAAGGAAGAAGTGTTCCCTCTAATTTCTCCCTGTCCCAGTATATAACCTGCTATCTTGGGGCAG

CTTTTGATGTCTGACATGTCACCCTTCCCAAGTTGGTCTCTTCCAACACTGCTGTCTTCACGTGGCACCCTCTTACCACAACCCTAACTCTGGTCATTTG

TGCCTTTCTCTTGTCATCTCTGTACACTACTAATATTCACTGTGGGTTGGGGAGCTGATTTTAAGCATGTTCAGTGGCTCCCCTCCAGTTTCAGTGTAAC

TGTTAAAATGTATCCAAAAGCCACTTCACTGGGGGTTTTCTTAAGGGGTAAAGGCCTTTTACAGATGCTGAGCCCTCCCCACATGTGGCAGAATGTGCTC

TTCTGTATCTACTCAATAAAGCATGTTCTCTGCTC
Translation
MPRRK - UNI2477 - - UNI17568 - RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQD - UNI22 - DSSPVRNL

PSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRE - UNI5647 - ETKNTADHDESPPRTPTGNAPSSESDIDISSPNVS

HDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLG - UNI5671 - GHLTGKHERHFSISGCPLYHNLSADECK APTERQLRYKEK

VAELRKKRNSGLSKEQKEKYM - UNI37495 - EHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDL - UNI37495 - EKLRLQGQITEGSN

MIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM - UNI37495 - AKCVWKHPPGDEIYRKGSISVFEVDGKKNK IYCQN

LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK EKNSFLNYNVSCILTMPQYMRQGYGKMLIDFS SYLLSKVEEKVGSPERPLSDLGLI

SYRSYWKEVLLRYLHNFQGKEISIKE EISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQ DLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Transcript ENSMUST00000103159
Sequence
GAAGGCTCTAGACGCTGAGAGGTAGGAGGCACTTGGGATCGTCCGCAGGGTTTGGGACAGCTACAGAGGCCGCCACGGAGCCCGCCGGAGCCCCCGTTCC

TGCTGGTGCTGCCGCCGCCCGAATCGGAACCGTCGGGCTGCAGCCGCCGGCAATGCCGCGAAGGAAG - UNI2477 - - UNI17568 - AGAAATG

CAGGCAGTAGTTCAGATGGAACCGAAGATTCCGATTTTTCTACAGATCTCGAGCATACAGACAGTTCAGAGAGTGATGGCACCTCGCGCCGATCTGCCCG

AGTCACCCGCTCCTCAGCCAGGCTAAGCCAGAGTTCCCAAG - UNI22 - - UNI5647 - AAACTAAAAATACAGCTGATCATGATGAGTCACCAC

CTCGAACTCCAACCGGAAATGCACCTTCTTCTGAGTCTGACATAGACATCTCCAGCCCCAACGTGTCTCATGATGAGAGCATTGCCAAGGACATGTCCCT

GAAGGACTCAGGCAGTGATCTCTCTCACCGTCCCAAGCGACGTCGATTTCACGAAAGCTACAATTTCAACATGAAGTGTCCTACGCCGGGCTGCAACTCT

CTAG - UNI5671 - GACATCTTACAGGAAAGCACGAGAGACATTTCTCCATCTCAGGATGCCCGCTGTATCATAACCTCTCAGCTGACGAATGCAAG

 GCACCAACAGAGAGACAGCTGCGGTATAAGGAAAAGGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAGCAGAAGGAGAAATACATG

 - UNI37495 - GAACACAGACAGACCTATGGGAACACTCGGGAGCCTCTCTTGGAAAACCTGACAAGTGAATATGACTTAGATCTTTTCCGAAGAGC

ACAAGCCCGGGCTTCTGAGGATTTG - UNI37495 - GAGAAGTTAAGGCTTCAAGGCCAAATCACAGAGGGAAGCAACATGATTAAAACAATTGCTT

TTGGCCGCTATGAACTGGACACTTGGTACCACTCTCCCTATCCTGAGGAATATGCGAGGCTGGGACGTCTCTACATGTGTGAATTCTGCTTAAAGTACAT

GAAGAGCCAGACAATCCTCCGCCGACACATG - UNI37495 - GCCAAGTGTGTGTGGAAACACCCCCCTGGTGATGAGATTTATCGCAAAGGCTCCA

TCTCTGTGTTTGAAGTAGACGGCAAGAAGAACAAG ATCTACTGCCAAAACCTCTGCCTTTTGGCAAAGCTTTTTCTGGACCATAAGACGCTATACTATG

ATGTAGAACCTTTCCTGTTCTACGTTATGACAGAAGCGGACAATACTGGCTGTCATCTGATTGGATATTTTTCTAAG GAGAAGAATTCATTTCTCAACT

ATAATGTCTCGTGCATCCTCACCATGCCTCAGTACATGCGACAGGGCTACGGGAAGATGCTGATCGATTTCA GTTATTTACTTTCCAAAGTAGAAGAGA

AAGTCGGCTCTCCAGAGCGCCCACTGTCAGACCTGGGGCTCATAAGCTACCGCAGCTACTGGAAGGAGGTACTGCTCCGATACCTGCACAACTTCCAGGG

CAAGGAGATCTCCATCAAAG AAATTAGCCAGGAAACAGCTGTGAATCCCGTGGACATTGTCAGCACTCTGCAAGCCCTTCAGATGCTCAAGTATTGGAA

AGGCAAGCACCTAGTTTTAAAGAGACAG GACCTGATAGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAACAAAACCATGGATCCAAGCTG

CTTAAAATGGACCCCTCCCAAGGGCACTTAAAGTGACCTATCATTCCGAGCCAGCGAGCCCCAGCAGTAGGAATCCGTACCCTAGGGATCTGTCTGTCAT

TTCTGTTGCTCTTGTGATTGGCAAGTACAGTATCCTTTGGGAAGGCCACCCCCTCAGCACTGTTCTGGCTCCAGCCTTCGTGTACACTGCAGACACTAGT

TCTGAGGAACTGTTGTTTCGGCCTCAGTGAGGTTGCCTGGACGGATCTGTATGAGGCTCGAGTACAGATCCCTCATAGCACTGACCCAAGGAGTTGTGTT

ATGGTACTGTACCTGTCCAGTCACTGGTTCCCACCTCATGCTTTTTAACTCCGAGGTTTGTTGTGTCCTGACCTTTGTGCTAGTGCTTTTTCCTGCCTGG

ATAGCAGACCTCCAAACATGGTTGCCACCAAAGGGCCCTTTCCAGTTACTTCTAACACATTCTTCATGAAGGGGTGGGCAAGAGGCAGCGCCTGTGCGTG

TCTGCTGGGAGGGTCCGCTCACCATGGGTTTCATCTCGCAGTCACTCATTTTTCTCCCTTTTTGTCAAAAGACTTACTACCTTTGATCAGGATCAGGCTG

CCCAGAGCTAGGAACGCCTGGCATTTCCCAGGGGTTCACAGGCCTGGTCCATCTGCGTGAGATGGTGAAGCCTAAGAGGTGGTCCCATGCTTTCCTTTGT

ATTTACTTGTGGACACTGGGGCAGCATTGTGTAGAAGGAAATGAGGAATTCTTTGCCACAGCAGAAAATGCCCCCACTTTTTTTTCTGCCCCCTTTTATG

TTGGTAGTTGCCAAAATATTTTAACAGTCTTTTTTCATACATTAAATGACCACCCTGTGGATCTTTCCACACCTGCCTCTGCCAGTCTGGTGTAGGGCAG

CTCTACTTTCCACACAAGTTGCACTGATCTTGTCCAGAGCTTCCTGGGAGAAGTGGAAACTGGTTGAAATGCTTGTGTTTCTCAGCCCATGACTCAGCAA

GACAGGGTGGCCACTCTGCTACGGTTTGCTTCGCTCTCAACAGTGCCTCCCTCCCCCAGCAGACTGAAGTGCTTCTGTCTAAGAACTAAGTCCATTCCCT

TTCGGGACTTGCCACCATCATCCTGTTCTCTGGGTTCCTATTTTTGGTGGTGTTAAGTGAAGGAAGAAGTGTTCCCTCTAATTTCTCCCTGTCCCAGTAT

ATAACCTGCTATCTTGGGGCAGCTTTTGATGTCTGACATGTCACCCTTCCCAAGTTGGTCTCTTCCAACACTGCTGTCTTCACGTGGCACCCTCTTACCA

CAACCCTAACTCTGGTCATTTGTGCCTTTCTCTTGTCATCTCTGTACACTACTAATATTCACTGTGGGTTGGGGAGCTGATTTTAAGCATGTTCAGTGGC

TCCCCTCCAGTTTCAGTGTAACTGTTAAAATGTATCCAAAAGCCACTTCACTGGGGGTTTTCTTAAGGGGTAAAGGCCTTTTACAGATGCTGAGCCCTCC

CCACATGTGGCAGAATGTGCTCTTCTGTATCTACTCAATAAAGCATGTTCTCTGCTC
Translation
MPRRK - UNI2477 - - UNI17568 - RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQE - UNI22 - - UNI564

7 - ETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLG - UNI5671 - GH

LTGKHERHFSISGCPLYHNLSADECK APTERQLRYKEKVAELRKKRNSGLSKEQKEKYM - UNI37495 - EHRQTYGNTREPLLENLTSEYDLDLF

RRAQARASEDL - UNI37495 - EKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM - UNI37495

 - AKCVWKHPPGDEIYRKGSISVFEVDGKKNK IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK EKNSFLNYNVSCILTMPQ

YMRQGYGKMLIDFS SYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKE EISQETAVNPVDIVSTLQALQMLKYWKGKHLVLK

RQ DLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Transcript ENSMUST00000092766
Sequence
ATGGCGATAGGTGTTGTAAAG - UNI17568 - AGAAATGCAGGCAGTAGTTCAGATGGAACCGAAGATTCCGATTTTTCTACAGATCTCGAGCATAC

AGACAGTTCAGAGAGTGATGGCACCTCGCGCCGATCTGCCCGAGTCACCCGCTCCTCAGCCAGGCTAAGCCAGAGTTCCCAAG - UNI22 - ATTCCA

GCCCTGTTCGAAATTTGCCGTCTTTCGGCACTGAGGAGCCTGCCTATTCTACCAGAAGGGTGACCCGTAGTCAGCAGCAGCCCACGCCAGTGACTCCAAA

AAAGTACCCTCTTCGACAGACTCGCTCATCTGGCTCTGAAACGGAGCAGGTGGTGGACTTTTCAGATAGAG - UNI5647 - AAACTAAAAATACAGC

TGATCATGATGAGTCACCACCTCGAACTCCAACCGGAAATGCACCTTCTTCTGAGTCTGACATAGACATCTCCAGCCCCAACGTGTCTCATGATGAGAGC

ATTGCCAAGGACATGTCCCTGAAGGACTCAGGCAGTGATCTCTCTCACCGTCCCAAGCGACGTCGATTTCACGAAAGCTACAATTTCAACATGAAGTGTC

CTACGCCGGGCTGCAACTCTCTAG - UNI5671 - GACATCTTACAGGAAAGCACGAGAGACATTTCTCCATCTCAGGATGCCCGCTGTATCATAACC

TCTCAGCTGACGAATGCAAG GTGAGAGCACAGAGCCGGGATAAGCAGATAGAAGAAAGGATGCTGTCCCACAGGCAAGATGACAACAACAGGCATGCAA

CCAGGCACCAG GCACCAACAGAGAGACAGCTGCGGTATAAGGAAAAGGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAGCAGAAGG

AGAAATACATG - UNI37495 - GAACACAGACAGACCTATGGGAACACTCGGGAGCCTCTCTTGGAAAACCTGACAAGTGAATATGACTTAGATCTT

TTCCGAAGAGCACAAGCCCGGGCTTCTGAGGATTTG - UNI37495 - GAGAAGTTAAGGCTTCAAGGCCAAATCACAGAGGGAAGCAACATGATTAA

AACAATTGCTTTTGGCCGCTATGAACTGGACACTTGGTACCACTCTCCCTATCCTGAGGAATATGCGAGGCTGGGACGTCTCTACATGTGTGAATTCTGC

TTAAAGTACATGAAGAGCCAGACAATCCTCCGCCGACACATG - UNI37495 - GCCAAGTGTGTGTGGAAACACCCCCCTGGTGATGAGATTTATCG

CAAAGGCTCCATCTCTGTGTTTGAAGTAGACGGCAAGAAGAACAAG ATCTACTGCCAAAACCTCTGCCTTTTGGCAAAGCTTTTTCTGGACCATAAGAC

GCTATACTATGATGTAGAACCTTTCCTGTTCTACGTTATGACAGAAGCGGACAATACTGGCTGTCATCTGATTGGATATTTTTCTAAG GAGAAGAATTC

ATTTCTCAACTATAATGTCTCGTGCATCCTCACCATGCCTCAGTACATGCGACAGGGCTACGGGAAGATGCTGATCGATTTCA GTTATTTACTTTCCAA

AGTAGAAGAGAAAGTCGGCTCTCCAGAGCGCCCACTGTCAGACCTGGGGCTCATAAGCTACCGCAGCTACTGGAAGGAGGTACTGCTCCGATACCTGCAC

AACTTCCAGGGCAAGGAGATCTCCATCAAAG AAATTAGCCAGGAAACAGCTGTGAATCCCGTGGACATTGTCAGCACTCTGCAAGCCCTTCAGATGCTC

AAGTATTGGAAAGGCAAGCACCTAGTTTTAAAGAGACAG GACCTGATAGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAACAAAACCATG

GATCCAAGCTGCTTAAAATGGACCCCTCCCAAGGGCACTTAAAGTGACCTATCATTCCGAGCCAGCGAGCCCCAGCAGTAGGAATCCGTACCCTAGGGAT

CTGTCTGTCATTTCTGTTGCTCTTGTGATTGGCAAGTACAGTATCCTTTGGGAAGGCCACCCCCTCAGCACTGTTCTGGCTCCAGCCTTCGTGTACACTG

CAGACACTAGTTCTGAGGAACTGTTGTTTCGGCCTCAGTGAGGTTGCCTGGACGGATCTGTATGAGGCTCGAGTACAGATCCCTCATAGCACTGACCCAA

GGAGTTGTGTTATGGTACTGTACCTGTCCAGTCACTGGTTCCCACCTCATGCTTTTTAACTCCGAGGTTTGTTGTGTCCTGACCTTTGTGCTAGTGCTTT

TTCCTGCCTGGATAGCAGACCTCCAAACATGGTTGCCACCAAAGGGCCCTTTCCAGTTACTTCTAACACATTCTTCATGAAGGGGTGGGCAAGAGGCAGC

GCCTGTGCGTGTCTGCTGGGAGGGTCCGCTCACCATGGGTTTCATCTCGCAGTCACTCATTTTTCTCCCTTTTTGTCAAAAGACTTACTACCTTTGATCA

GGATCAGGCTGCCCAGAGCTAGGAACGCCTGGCATTTCCCAGGGGTTCACAGGCCTGGTCCATCTGCGTGAGATGGTGAAGCCTAAGAGGTGGTCCCATG

CTTTCCTTTGTATTTACTTGTGGACACTGGGGCAGCATTGTGTAGAAGGAAATGAGGAATTCTTTGCCACAGCAGAAAATGCCCCCACTTTTTTTTCTGC

CCCCTTTTATGTTGGTAGTTGCCAAAATATTTTAACAGTCTTTTTTCATACATTAAATGACCACCCTGTGGATCTTTCCACACCTGCCTCTGCCAGTCTG

GTGTAGGGCAGCTCTACTTTCCACACAAGTTGCACTGATCTTGTCCAGAGCTTCCTGGGAGAAGTGGAAACTGGTTGAAATGCTTGTGTTTCTCAGCCCA

TGACTCAGCAAGACAGGGTGGCCACTCTGCTACGGTTTGCTTCGCTCTCAACAGTGCCTCCCTCCCCCAGCAGACTGAAGTGCTTCTGTCTAAGAACTAA

GTCCATTCCCTTTCGGGACTTGCCACCATCATCCTGTTCTCTGGGTTCCTATTTTTGGTGGTGTTAAGTGAAGGAAGAAGTGTTCCCTCTAATTTCTCCC

TGTCCCAGTATATAACCTGCTATCTTGGGGCAGCTTTTGATGTCTGACATGTCACCCTTCCCAAGTTGGTCTCTTCCAACACTGCTGTCTTCACGTGGCA

CCCTCTTACCACAACCCTAACTCTGGTCATTTGTGCCTTTCTCTTGTCATCTCTGTACACTACTAATATTCACTGTGGGTTGGGGAGCTGATTTTAAGCA

TGTTCAGTGGCTCCCCTCCAGTTTCAGTGTAACTGTTAAAATGTATCCAAAAGCCACTTCACTGGGGGTTTTCTTAAGGGGTAAAGGCCTTTTACAGATG

CTGAGCCCTCCCCACATGTGGCAGAATGTGCTCTTCTGTATCTACTCAATAAAGCATGTTCTCTGCTC
Translation
MAIGVVK - UNI17568 - RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQD - UNI22 - DSSPVRNLPSFGTEEPAY

STRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRE - UNI5647 - ETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMS

LKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLG - UNI5671 - GHLTGKHERHFSISGCPLYHNLSADECK VRAQSRDKQIEERMLSHRQDDN

NRHATRHQ APTERQLRYKEKVAELRKKRNSGLSKEQKEKYM - UNI37495 - EHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDL - UNI3

7495 - EKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM - UNI37495 - AKCVWKHPPGDEIYR

KGSISVFEVDGKKNK IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK EKNSFLNYNVSCILTMPQYMRQGYGKMLIDFS SYL

LSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKE EISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQ DLIDEWIAKEAKRSN

SNKTMDPSCLKWTPPKGT
Transcript ENSMUST00000072621
Sequence
AAGGCCTGGATTGGGGCGACCAACGCCCCGCCCTTCCGGATAGAGATGGCGATAGGTGTTGTAAAG - UNI17568 - AGAAATGCAGGCAGTAGTTC

AGATGGAACCGAAGATTCCGATTTTTCTACAGATCTCGAGCATACAGACAGTTCAGAGAGTGATGGCACCTCGCGCCGATCTGCCCGAGTCACCCGCTCC

TCAGCCAGGCTAAGCCAGAGTTCCCAAG - UNI22 - ATTCCAGCCCTGTTCGAAATTTGCCGTCTTTCGGCACTGAGGAGCCTGCCTATTCTACCAG

AAGGGTGACCCGTAGTCAGCAGCAGCCCACGCCAGTGACTCCAAAAAAGTACCCTCTTCGACAGACTCGCTCATCTGGCTCTGAAACGGAGCAGGTGGTG

GACTTTTCAGATAGAG - UNI5647 - AAACTAAAAATACAGCTGATCATGATGAGTCACCACCTCGAACTCCAACCGGAAATGCACCTTCTTCTGAG

TCTGACATAGACATCTCCAGCCCCAACGTGTCTCATGATGAGAGCATTGCCAAGGACATGTCCCTGAAGGACTCAGGCAGTGATCTCTCTCACCGTCCCA

AGCGACGTCGATTTCACGAAAGCTACAATTTCAACATGAAGTGTCCTACGCCGGGCTGCAACTCTCTAG - UNI5671 - GACATCTTACAGGAAAGC

ACGAGAGACATTTCTCCATCTCAGGATGCCCGCTGTATCATAACCTCTCAGCTGACGAATGCAAG GCACCAACAGAGAGACAGCTGCGGTATAAGGAAA

AGGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAGCAGAAGGAGAAATACATG - UNI37495 - GAACACAGACAGACCTATGGG

AACACTCGGGAGCCTCTCTTGGAAAACCTGACAAGTGAATATGACTTAGATCTTTTCCGAAGAGCACAAGCCCGGGCTTCTGAGGATTTG - UNI3749

5 - GAGAAGTTAAGGCTTCAAGGCCAAATCACAGAGGGAAGCAACATGATTAAAACAATTGCTTTTGGCCGCTATGAACTGGACACTTGGTACCACTCT

CCCTATCCTGAGGAATATGCGAGGCTGGGACGTCTCTACATGTGTGAATTCTGCTTAAAGTACATGAAGAGCCAGACAATCCTCCGCCGACACATG - U

NI37495 - GCCAAGTGTGTGTGGAAACACCCCCCTGGTGATGAGATTTATCGCAAAGGCTCCATCTCTGTGTTTGAAGTAGACGGCAAGAAGAACAAG

 ATCTACTGCCAAAACCTCTGCCTTTTGGCAAAGCTTTTTCTGGACCATAAGACGCTATACTATGATGTAGAACCTTTCCTGTTCTACGTTATGACAGAA

GCGGACAATACTGGCTGTCATCTGATTGGATATTTTTCTAAG GAGAAGAATTCATTTCTCAACTATAATGTCTCGTGCATCCTCACCATGCCTCAGTAC

ATGCGACAGGGCTACGGGAAGATGCTGATCGATTTCA GTTATTTACTTTCCAAAGTAGAAGAGAAAGTCGGCTCTCCAGAGCGCCCACTGTCAGACCTG

GGGCTCATAAGCTACCGCAGCTACTGGAAGGAGGTACTGCTCCGATACCTGCACAACTTCCAGGGCAAGGAGATCTCCATCAAAG AAATTAGCCAGGAA

ACAGCTGTGAATCCCGTGGACATTGTCAGCACTCTGCAAGCCCTTCAGATGCTCAAGTATTGGAAAGGCAAGCACCTAGTTTTAAAGAGACAG GACCTG

ATAGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAACAAAACCATGGATCCAAGCTGCTTAAAATGGACCCCTCCCAAGGGCACTTAAAGTG

ACCTATCATTCCGAGCCAGCGAGCCCCAGCAGTAGGAATCCGTACCCTAGGGATCTGTCTGTCATTTCTGTTGCTCTTGTGATTGGCAAGTACAGTATCC

TTTGGGAAGGCCACCCCCTCAGCACTGTTCTGGCTCCAGCCTTCGTGTACACTGCAGACACTAGTTCTGAGGAACTGTTGTTTCGGCCTCAGTGAGGTTG

CCTGGACGGATCTGTATGAGGCTCGAGTACAGATCCCTCATAGCACTGACCCAAGGAGTTGTGTTATGGTACTGTACCTGTCCAGTCACTGGTTCCCACC

TCATGCTTTTTAACTCCGAGGTTTGTTGTGTCCTGACCTTTGTGCTAGTGCTTTTTCCTGCCTGGATAGCAGACCTCCAAACATGGTTGCCACCAAAGGG

CCCTTTCCAGTTACTTCTAACACATTCTTCATGAAGGGGTGGGCAAGAGGCAGCGCCTGTGCGTGTCTGCTGGGAGGGTCCGCTCACCATGGGTTTCATC

TCGCAGTCACTCATTTTTCTCCCTTTTTGTCAAAAGACTTACTACCTTTGATCAGGATCAGGCTGCCCAGAGCTAGGAACGCCTGGCATTTCCCAGGGGT

TCACAGGCCTGGTCCATCTGCGTGAGATGGTGAAGCCTAAGAGGTGGTCCCATGCTTTCCTTTGTATTTACTTGTGGACACTGGGGCAGCATTGTGTAGA

AGGAAATGAGGAATTCTTTGCCACAGCAGAAAATGCCCCCACTTTTTTTTCTGCCCCCTTTTATGTTGGTAGTTGCCAAAATATTTTAACAGTCTTTTTT

CATACATTAAATGACCACCCTGTGGATCTTTCCACACCTGCCTCTGCCAGTCTGGTGTAGGGCAGCTCTACTTTCCACACAAGTTGCACTGATCTTGTCC

AGAGCTTCCTGGGAGAAGTGGAAACTGGTTGAAATGCTTGTGTTTCTCAGCCCATGACTCAGCAAGACAGGGTGGCCACTCTGCTACGGTTTGCTTCGCT

CTCAACAGTGCCTCCCTCCCCCAGCAGACTGAAGTGCTTCTGTCTAAGAACTAAGTCCATTCCCTTTCGGGACTTGCCACCATCATCCTGTTCTCTGGGT

TCCTATTTTTGGTGGTGTTAAGTGAAGGAAGAAGTGTTCCCTCTAATTTCTCCCTGTCCCAGTATATAACCTGCTATCTTGGGGCAGCTTTTGATGTCTG

ACATGTCACCCTTCCCAAGTTGGTCTCTTCCAACACTGCTGTCTTCACGTGGCACCCTCTTACCACAACCCTAACTCTGGTCATTTGTGCCTTTCTCTTG

TCATCTCTGTACACTACTAATATTCACTGTGGGTTGGGGAGCTGATTTTAAGCATGTTCAGTGGCTCCCCTCCAGTTTCAGTGTAACTGTTAAAATGTAT

CCAAAAGCCACTTCACTGGGGGTTTTCTTAAGGGGTAAAGGCCTTTTACAGATGCTGAGCCCTCCCCACATGTGGCAGAATGTGCTCTTCTGTATCTACT

CAATAAAGCATGTTCTCTGCTCA
Translation
MAIGVVK - UNI17568 - RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQD - UNI22 - DSSPVRNLPSFGTEEPAY

STRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRE - UNI5647 - ETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMS

LKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLG - UNI5671 - GHLTGKHERHFSISGCPLYHNLSADECK APTERQLRYKEKVAELRKKRNS

GLSKEQKEKYM - UNI37495 - EHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDL - UNI37495 - EKLRLQGQITEGSNMIKTIAFGRY

ELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM - UNI37495 - AKCVWKHPPGDEIYRKGSISVFEVDGKKNK IYCQNLCLLAKLFLD

HKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK EKNSFLNYNVSCILTMPQYMRQGYGKMLIDFS SYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVL

LRYLHNFQGKEISIKE EISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQ DLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT

For any suggestions or comments, please send an email to unitrap@crg.es