Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038914 (Dido1)
Chromosomal location
Chr 2: 180392669 - 180444704 (-)
Description
death inducer-obliterator 1 Gene [Source:MGI (curated);Acc:Dido1-002]
RefSeq_dna
NM_175551 NM_177852 NM_011805 
RefSeq_peptide
NP_780760.2 NP_808520.2 NP_035935.2 
UniGene
Mm.253836 Mm.413255 Mm.412167 
MGI
MGI:1344352 
Uniprot/SWISSPROT
Q8C9B9 
Uniprot/SPTREMBL
B2RS46 
Human Ortholog
ENSG00000101191 (DIDO1)
Omim not available
UniTrap UNI6398
Vector Insertion
Chr 2: 180436806 - 180444614
Public Clones (sanger) YHC046 (baygenomics) RRL002 (baygenomics) W257A06 (ggtc)
P056E04 (ggtc) P026F08 (ggtc) W233F05 (ggtc) M049F05 (ggtc) P140H10 (ggtc)
P117G10 (ggtc) H011G03 (ggtc) E091D04 (ggtc) E064A04 (ggtc) D159H01 (ggtc)
D045A05 (ggtc) D039E07 (ggtc) D004A07 (ggtc) P147F02 (ggtc) P117F10 (ggtc)
P012D06 (ggtc) W271B05 (ggtc) P125E03 (ggtc) P105C08 (ggtc) H004B05 (ggtc)
E076G03 (ggtc) E045A08 (ggtc) D127G04 (ggtc) D042G06 (ggtc) D022G03 (ggtc)
P144B02 (ggtc) P065C12 (ggtc) P005B12 (ggtc) W274D07 (ggtc) P121G09 (ggtc)
P104C11 (ggtc) E121D04 (ggtc) E068C12 (ggtc) E037C01 (ggtc) D048H10 (ggtc)
D039E09 (ggtc) D018B02 (ggtc) P111B12 (ggtc) P081E11 (ggtc) W268A05 (ggtc)
W178A03 (ggtc) P135B12 (ggtc) E079G12 (ggtc) E047A05 (ggtc) D144F09 (ggtc)
D026C06 (ggtc) 5SE386A11 (ggtc) M124E08 (ggtc) P007F10 (ggtc) W238F07 (ggtc)
P150G06 (ggtc) P122B07 (ggtc) P105A02 (ggtc) E076D08 (ggtc) D089E02 (ggtc)
D041F12 (ggtc) D022F03 (ggtc) P033D10 (ggtc) P062B03 (ggtc) P015F02 (ggtc)
W176B05 (ggtc) P121E10 (ggtc) D183B01 (ggtc) D007F12 (ggtc) P147G07 (ggtc)
P110G10 (ggtc) P088H07 (ggtc) W211C03 (ggtc) W175B07 (ggtc) P133G06 (ggtc)
H007F06 (ggtc) E045A09 (ggtc) D026B04 (ggtc) D002C02 (ggtc) M119C02 (ggtc)
P005A12 (ggtc) W243A04 (ggtc) H003F11 (ggtc) E043H03 (ggtc) D081C10 (ggtc)
D041E11 (ggtc) PST11931-NL (escells) PST24935-NR (escells) IST14184H6 (tigm)
IST13570F7 (tigm) IST14980E1 (tigm) IST10583D6 (tigm) IST11683H5 (tigm)
IST15111F1 (tigm) IST11711B5BBF1 (tigm) IST15053G2 (tigm) IST14649H12 (tigm)
IST14568B10 (tigm) IST12945E8 (tigm) IST14435E4 (tigm) IST14677F6 (tigm)
IST10439H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22601
Vector Insertion
Chr 2: 180426754 - 180436665
Public Clones (sanger) P144D03 (ggtc) D020A11 (ggtc) D042F05 (ggtc) P149F11 (ggtc)
D031H07 (ggtc) P138F03 (ggtc) D006C01 (ggtc) P147G07 (ggtc) H006D07 (ggtc)
IST14162D10 (tigm)
Private Clones OST290558 (lexicon) OST238033 (lexicon) OST221808 (lexicon) OST208387 (lexicon)
OST187929 (lexicon) OST149722 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI351
Vector Insertion
Chr 2: 180424361 - 180426568
Public Clones GC0949 (tigem) RRB044 (baygenomics) P107C02 (ggtc) P100C08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29527
Vector Insertion
Chr 2: 180423528 - 180426754
Public Clones P101C10 (ggtc) P107C02 (ggtc) D110C11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10154
Vector Insertion
Chr 2: 180418734 - 180419668
Public Clones XB629 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15101
Vector Insertion
Chr 2: 180415762 - 180419882
Public Clones PST12857-NR (escells) PST10670-NR (escells) PST13368-NL (escells) PST9621-NL (escells)
PST4238-NL (escells) PST13296-NR (escells) PST3942-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15315
Vector Insertion
Chr 2: 180409672 - 180418734
Public Clones PST8061-NL (escells) PST3080-NR (escells) PST56-3 (escells) PST0056-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14814
Vector Insertion
Chr 2: 180409672 - 180418734
Public Clones PST11834-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31653
Vector Insertion
Chr 2: 180408179 - 180409556
Public Clones IST14311D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3202
Vector Insertion
Chr 2: 180408041 - 180408179
Public Clones XR0002 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9454
Vector Insertion
Chr 2: 180406620 - 180406987
Public Clones RRD071 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12442
Vector Insertion
Chr 2: 180404292 - 180404969
Public Clones A027A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12280
Vector Insertion
Chr 2: 180397289 - 180402994
Public Clones A045E05 (ggtc) CMHD-GT_312H11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087517
Sequence
TCTAGCCTCGCCGTAGCTCGGTGGCCGGTCGATTTCTTCCGCTTGCCGCGCGGCCTACCACTCTAGGACGGTAGTCTCGCTGGTCTCTGCTCTATATCCG

TGGTAGCTCTGGAAATGGCTGCGGGATCCCGGCGGCCGGG - UNI22601 - - UNI29527 - GAGCTTGTTTAAGAGGCAGTCCCCACTGTCCCT

TTGGTTGTTCGAAGCTCCGGAATCTTCTCATTGATGAACTGTGACTGACAACAGTGGGGTGAGGCTTGGCCGTCTGCTTGACCTGGCCCCAGGTCTATAA

TTTTATGTAGGATTTCCAGCCAAAGGTTTCCAAGCTTTCAGTTTTGGGACAG - UNI351 - - UNI29527 - GTATGGATGATAAAGGGCACCTG

AGCAATGAGGAAGCACCCAAGGCTATCAAACCCACCAGTAAGGAGTTCAGGAAAACCTGGGGTTTTCGAAGAACCACGATTGCCAAACGTGAGGGTGCAG

GAGACACGGAGGTGGACCCCAGTGAGCAGCAACCACAGCAGCATAACCTCTCCCTGCGCCGCAGTGGACGGCAACCAAAACGTACTGAGAGGGTAGAAGA

GTTTCTTACCACGGTTCGGCGCCGAGGGAAAAAGAATGTGCCGGTGTCCCTGGAGGATTCCAGTGAGCCCACATCTTCCACAGTCACTGATGTGGAGACA

GCTTCCGAGGGGAGCGTTGAAAGCAGTTCTGAGATCAGAAGTGGCCCTGTATCTGACTCCTTAGGGAAAGAACATCCTGCCTCTTCTGAAAAGGCAAAAG

GAGGTGAAGAGGAAGAAGACACCTCTGACAGTGACAGTGATGGCCTTACGTTGAAGGAACTTCAGAACCGCCTTCGGAGAAAGCGAGAGCAAGAACCTGT

GGAGAGGTCCCTGAGAGGCAGTCAGAATCGCCTGAGGAAGAAGCGCAGAGAGGAAGATTCTGCCGAAACTGGGAGTGTCCAAATAGGCAGTGCCGAGCAG

GACAGACCTCTCTGTAAGCAGGAGCCTGAGGCTAGTCAGGGACCAGTGTCCCAGTCAGAGACAGATGACATAGAAAATCAGTTGGAAGGGAAGGCGACTC

AGGGAAATACAGAGGAAAACCCCAGGGAAGCGGGCAAACCAAAGCCTGAGTGTGAGGTTTACGACCCCAATGCCCTGTACTGCATCTGCCGCCAGCCTCA

CAACAACAG - UNI29527 - GTTTATGATCTGCTGTGATCGGTGTGAGGAGTGGTTCCATGGTGACTGTGTGGGTATTTCTGAGGCCCGAGGGCGGC

TCCTGGAAAGGAACGGGGAAGACTACATCTGCCCAAATTGCACCATTTTGCAAGTGCAGGATGAGACAAACGGTAGCGCCACCGATGAGCAGGACTCTGG

GTGCAGATCTGTGGGTGCTGATGGCACAGACTGCACAAGCATAGGGACAGTAGAGCAGAAGTCCGGAGAAGACCAGGGCATAAAGGGTAGGATTGAGAAG

GCAGCAAACCCCAGCGGCAAGAAAAAACTCAAGATATTCCAGCCT - UNI15101 - GTCGTAGAGGCTCCTGGTGCTCCTAAATGCATTGGCCCTGG

GTGTTCCAGTGTAGCACAGCCTGACTCTGTGTATTGCAGTAATGACTGCATTCTCAAACACGCAGCAGCTACCATGAGATTTCTAAGTTCAGGTAAAGAA

CAAAAAACAAAACCCAAGGAAAAGGTCAAGACGAAGCCAGAAAAGTTCAGTCTTCCAAAATGCAGTGTTCAG - UNI10154 - - UNI14814 - -

 UNI15101 - - UNI15315 - GTGGGGATTAAAATCTCTTCTGTGCACAAGAGACTAGCGTCAGAGAAAAGGGAAAACCCAGTGAAGAAAGTGATG

CTGGCTTCCAGGAGTGAGACTTCTGGGAAGGAGGCAGCCTGTGAGAGCAGCACACCATCCTGGGCAAGTGACCACAACTACAATGCTGTGAAGCCAGAGA

AGCCAGAGAAGCCCACTGCACTCTCGCCCACCCTATTGAGTAAAT - UNI14814 - - UNI15101 - - UNI15315 - CCATGAAGGATGACA

GGAGGGTGGAGGACAGGACAATGGCAGCAGTTACCATCCCGAAGAAAGCACTTCCTTCAGCCTCTTTGGTGGGCAGACAGACTTCACCTAGGAATCTTGT

TCCAAAGAAGCTTCCTCCTTACTCTAATATGGCAGGAGCCAAACCAGCCATTAAGAAACTGCCTTCAGGCTTCAAGGGTACCATCCCCAAGAGGCCATGG

CCCTCAGCCACCCTGTCAGGCACTTCTGCCAGGCAGGCAGGACCAACACCTATGACAGCTGCTTCCAAAAAGTTGCCTGGCTCTGCTGCTGTGGTGGGAG

TTACCAGGAAGCCAATGTCTGCCAATGTTCCTGCTGCTTCTCCAGCCCCAGGACGGCTTGGTCCTGTGAGCCCAGCTCCATCACAGCCCAATTCACAAAT

TCGACAAAATATAAGGCGCTCCTTGAAAGAGATTTTGTGGAAAAG - UNI14814 - - UNI15315 - - UNI31653 - AGTCAATGACAGCGA

TGACTTAATAATGACAGAAAATGAAGTAGGAAAAATTGCCCTCCACATTGAGAAGGAGATGTTTAACTTGTTCCAGGTTACTGATAATCGCTATAAGAGC

AAATATCGCAGCATCATGTTCAACCTTAAGGATCCTAAGAATCAG - UNI31653 - GGGCTCTTCCATCGTGTTCTTCGAGAAGAAATCTCCTTGGC

AAAACTTGTCAGAATGAAGCCTGAAGAACTTGTATCTAAAGAGCTTTCTATGTGGACAGAGAAGCCCACAAAATCT - UNI3202 - - UNI31653 

- GTGATAGAATCCAGGACTAAGTTGCTTAATGAAAGCAAGAAGAACACTACTAAACCAGAAACCATTCCTGACATGGAAGATTCTCCACCGGTATCAGA

TTCAGAA GAACAACAAGAGTCAGTGCGAGCCGCCCCTGAGAAGAGCGCAGCACCTCTCCTGGACGTCTTCAGCAGCATGCTGAAGGACACCACAAGCCA

GCACCGTGCCCATCTTTTTGATTTAAACTGTAAAATCTGTACAG - UNI9454 - GTCAGGTTCCATCCTCGGAGGATGAACCAGCTCCTAAGAAGCA

AAAGCTTTCAGCTTCTTCTAAGAAGGAAGACTTTAAGCCCAGGCATGACAGCTCTCCACCTAATGCAGTTCCTAACACTGCTGATGAAGGGATTGCAGAC

ACGCTGCCTGAAAATGCCTCTGAGCCAGACCCGGAGAGTACATCTAGTCTTAACCAGGAGAGAAAGTGTTTCCCTGAGTCTCCAGGCGATAGCCATCCTG

AGCCCTCGTCTCTGGGTGGCCTTTCTCCCTCTTCTGCCTCTGGTGGGAGTGGGGTGGTCACCACAGTCACCATGTCTGGTCGAGACCCCAGAACTGCCCT

GAGTGGGTCGTGCACAGTCACAGCCTCCATGGCAGCCCATCTGGACAACTCCCAGGCTTCAGAAACCAAACTGGACATGATAAAGCCTGCATTGACTTCT

GCAGTGGTGCCCAAGTCCATACTGGCTAAGCCATCCTCCTCTCCTGACCCGAGATACCTGTCAGTACCACCATCACCAAG CATTTCAGAATCACGATCC

CCACCAGAAGGAGATACAACCCTCTTTTTGTCTCGACTCAACACGATTTGGAAAGGATTTATTAATATGCAGAGTGTAGCAAAATTTGTCACTAAGGCAT

ATCCTGTCTCTGGGTGTTTGGATTATCTCAGTGAG GATTTGCCAGACACCATCCACATCGGTGGAAGGATTGCTCCAAAGACCGTGTGGGATTACGTTG

GCAAACTCAAGTCATCGGTGTCCAAG - UNI12442 - GAGCTCTGTCTGATCCGCTTCCACCCTGCCACTGAGGAGGAGGAGGTTGCATACATTTCT

CTCTACTCCTATTTTAGCAGCCGTGGTCGCTTTGGGGTTGTAGCTAATAACAACAGGCATGTCAAGGACCTGTACCTGATTCCACTGAGTGCTAAGGACC

CTGTGCCATCCAAACTCTTGCCCTTTGAGGGCCCAG - UNI12280 - GTCTTGAATCACCACGTCCAAATATAATACTTGGGTTAGTAATATGTCAG

AAAGTGAAACGTCCTTCAAGTGCTGGCGAGTTAGACAAGACAGATGAGAAGCGGACTCGACTCCAACAGGAAGAACTAGAAACTTCAGTCTATCCCAAAG

TAACTGCAGCTTTGCCATCCGAGAAGAAGCCTCCCAAGTACAGTGTACACTCTATAGACACAGCTGCTACCAGCACCACGCCCCCTGGCTCTCCTCCCCC

ACCTCCTCCTCTTCCTGAACCCCCAGTATTGAAAATACTGTCATCCCTCAAGCCAGGGTCCACCAGCACTGTCACAGCGCCTACCACAGCAGCAATCACT

ACCACAGCTTCCCCTGTTACTGCTGCCACTTCCAAAACAGCCTCGCCCCTGGAACACATCCTGCAGACTCTCTTTGGGAAAAAGAAATCATTTGAGCCGT

CTGGAAAAGAATCTGTTGGGTCTACTCTATCTCCACATCAGGATTCCAAGGCCAAGGGGGAGGACACCATGTCAGCAGCTCCTTTGTTGGATCCAATTGT

TCAACAGTTTGGTCAGTTCTCAAAAGACAAGGCTCTGGAGGAGGAGGAGGAAGATGACAGGCCCTACGACCCTGAAGAAGAGTACAACCCTGATCGAGCA

TTTCATACACTGCTCGCTGAGCCAGGGAGGCCTCATGATGTGCAGAGTGTGTCTGAGACAGCTGAGAGGGAGGAGGTGGCCTATGACCCAGAAGATGAGA

CCATCTTAGAAGAAGCCAAAGTGACCATTGATGACTTGCCCAATCGCATGTGTATGAAAGTTAGCGCCACAGAAAGGCCTGCCGACTTCACCACCGATGC

CTCCAGTGCTTCGCTGGTAGAGCAGCAGAAAATGTTAGAAGAGCTAAATAAACAGATTGAGGAGCAAAAGAGGCAGCTGGAGGAGCAAGAAGAAGCTCTC

CGACAGCAGAGGGCTGCTGTGGGTGTGTCCATGGCACACTTTTCTGTGTCCGATGCATTGATGTCACCACCTCCCAAGTCGTCTTTGGGCAAGACAGAGC

TGTTCTCTCAAGAACAGCAAGCCCCAGACCCAAGTCAGGGAGCCCCGAACACCAACCACAACCTAGACTCAAGACAAAGTAGGGACCCAAGGCAGGCCAG

GCGGCTCGCTGCAGAAAACACAGAGAATGAATCCCTTCCTAGGGCCCCCACAGGAAGCACACCTGGCCCACAAGGCACCCTACCTGCAAGGGAGACTCCT

GCTGGGACTGCAGTAGTCCAGGGGCCTGGGCTGGCAGCAGAAGCCAAGGAGTCAATGGCTGTTCCCTGGGCTCCAGGTGAAAACGCTGTGTTGAGACCTG

AACATGACATCCAAAAATGTGAGCACCCTGGTAACCCTGTCTCATTACCCCTGGACACCAGCCACCTTCCTACAGCTGGGGATGGCGCAGCCAGGCCAGC

ACCGCCCCGCAGAGTGCTGCTACCCACACCCCCTAGCACCACCTTTCCACCCAGCTTCCCTTTGCAACCTAAGGCCCAAAATTTTAGTTCTGGAAGCAGG

GAGCCTTTCTCAGGGCCCACATTTATGTCTCAGGAAACATCTCTTGGCTCATCCCAATATGAGGACCCCAGGGGTGCTCAGTCTGCTGGGAAGAATGACA

GCCCAGTAGCTGATATGGAGGACAGCAGAGAGCCACAGCCTAGGCCTGGTGAGAGTACTACTTCATTCCCCCAACCTGGGCAGAGGGGAGGGGGCCCTCA

GCCTCAGTTTCCTGGCCAGCGTGAACCTGCACCACGCACTTTTGGGATGTCGGGTCATCATGGTCCCAGTTTTCCAGGACCTAGGGGGCCAGTCCCTCCT

TATTCAGAAGAGAACCTTGTTCCTAATAGTGATGGACCAAGAGGCCCTCCACCTGCCAGATTTGGGGCACAGAAGCCACCAATCCCTTCCTTATTCTCTG

GGCAACATGGGCCACCTCCCTATGGGGACAACAGGGGACTCTCACCTTCTTATCTTGGTGGGCCCCGAGGAGGAGCACCAGCCCAATTTGAAGACCGCAA

GGATCCTCATGGGGAGAAAAGGGAATTCCAGGACACTCCGTACAACGAGATGACAGGTGCCCCTGCTCAGTGTGAAGGGCCAGATCAGGCCCAGTTCATG

GGGAACAGGGCACCCTTTCAGTTTGGAGGCCAGAGACGGCCACTGCTAACTCAAATGAAAGGGCCCCGTGGAGGACCTCCACCCTCTCAGTTTGGAGCCC

AAAGGGGACCACCTCCTGGTCATTTCGTGGGCCCACGTGGGCCCCATCCTAGTCAGTTTGAAAATTCCCGGGGCACTCACCCTGGCCAGTTTGAAGGGGC

CAGGGGCCAAGCACCTGGTTTCATGCCAGGCCCCCGGGGTATTCAGCCCCAGCAGTTCGAAGAGCAGAGAGTGAACTCGCCACCAAGGTTTGCCGGCCAG

AGGGCATCGGCGCCCCTGCCATATGGAGGACCAAGGGGCCCTGCACCCTTTCCTGAAAAAAATGAGCAGCCACCTTCTCGATTTCACTTTCAAGGCCCAT

CTTCACAGCCCGTGAAGCCTCCCCCGAGGCCCCTGTTGGAGCTACCAAGCCATCCTCCTCAGCATAGGAAGGACCGATGGGATGAGGCAGGCCCAGCCAC

TGCTCTGCCTTCCAGTGCTGGGCCTGGACAGGGCCATGAGGCCGACGGGCAGTGGGCCACATCAGAGTTCCGAGAAGGCAAAGGCCATGAATATAGGAGC

CCAGCTTTTGAAGGGAGACAGAGGGAGCGATTTGAAGCAGGATCTAAAGAAAAGCCTCTGGACGAGCCTGAAGCCCAAGGGTTGGAAAGCCGGCAGGGCC

GGGCATTTGAGGATAGGAGGCGAGAGCGAGAGAGAGGCAGAAACTGGAGTCGAGAAAGAGACTGGGAGAGGAGCCGGGACTGGGACCGGCATCGGGAGTG

GGATAAAGGCAGGGATAGGAGCTCCAACAGGGACAGGGAGCGAGACAACGACAGGGCTAAGGAATGGGACCGGAGCCGCGAGAGAAGCCGGAATCGCGAC

CGGGACCGAGAAAGGCGGCGAGACCGAGACAGGTCCCGCAGCAGAGACCGAGACAGGGACCGTGAGAGAGCACGAGACAGGGACAGGGACCGAGGCCGGG

ACCGGAAGGACCGCAGCAAGAGCAGAGAGAGCCCTCGGGACCAGAAGCCTGAGGCCAGGACCTCTGAGGGGGGCCCTGCTGCAGCCCAGGCCTAGAGGCC

ATTGCACTCGGGGCTGGGGACACGACCTGCTGGTGTGGACAAAGACCTGTGTCAGTTATTGTGTATATAGGCTCAGCCTGGCAAAGACCCCTTTAAAAGC

CAAGTGCATAAAATGTGTTGAGCAAAGAGTTTTTGAAATAGCTATGAACTTATATACAGGATATAATATTCTGGACTTCAGGAATTACTGTAATTTTGTG

TATAATGGTTTGTTACAAATTTTCCCAACTTTACAATTCTGATTTTTTAAAAATATTTCCATTTAAAATTAGAGAAATGGGAAAATGTCTACAAAAGCAT

ATTGCTTTTTTTCAGATTATAAAGTTTTTTCCAATAACTTGACTGGTGTAAGTTTTAAGGGGATTTCAGTGGACCTTAGAGCTAGCTTTCCCTGTGTAGC

CATCTCTGCTTCCGTCTATCCAGGGGCTTTCCTCAGTGCTGTCCTAGTCGGAAAGCACTATTGTCGAGGTGAGCTGGGGGCTGTGCGCAATTGCAGCGGT

GGAAGAACTGCCTTCTGAGGCCCGCCCAGCTCCCAGCAATGCAGCACCTTACAAGTTTTTTCAGAACTTAATTAGAAATAGCCTGTCCTAGTAGAAATTG

TAACATTTTTAAATAACAATTTATTTTTAAATGTTCAAATTTATCAGCCTAAAGAAAGAAAGATTCAGTTCAGAGCATTTAAGAGGGAAGAGACAGGAGT

CAAGCATTGCCCATTGCTGCCCTCTGAGTGGCTCTGCAGACTGACAGACTCCAGATAGGCGATGGGTTTGGAAGCTTCTCAGTGGGATGGGGCAATGTTT

GTACCAAATCTGGAAACGAAGAGGATGGTGGTGAAGCAGCCTGCTTCATGGAAGGATAACTGCTGTGTCGCCCCGGTTGCCTCTAAAGATGCTGTAAGAA

GGCTGGCTAACGTATCTGACTGTGCAAATATGTTTGATAGTTCCTTTTATATTTTCATAAACTTACTTTTTCAGATAGAGAATTAGCTTCGTTTGTTCTT

CGGAGTCTTATTTCACTGTACATCACTACAGATTTTTTCACTTTATAGCACAGATGTTTAAGTTGAAAAGACATGGGAAAATAGCAATTTGGGATATTTG

CTATTGTAAACCAAATAGTAGGCTAAATTACATGAAAGTGTCAGTTTCAACATCTAATATGTGAAGGTTTTTTGTTTTTTTAAAAAAGTGTAAAGTAAAA

TTTTCTAACTTAAATGCACAAGCATAAAAATCAAGTGTGTTTCTTTAGGTTTACTTTGTAGAAATTTCTGTACATTGTATTTTGTATTGCAGAGTGTTAT

ATCACTGTCCATTGAAACACAGGACTCCATAGGTTTTGTTACTTGAAGTAGAATAAATATCTACAGAGTT
Translation
 - UNI22601 - - UNI29527 -  - UNI351 - - UNI29527 - MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDTEVDPS

EQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTDVETASEGSVESSSEIRSGPVSDSLGKEHPASSEKAKGGEEEEDT

SDSDSDGLTLKELQNRLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGPVSQSETDDIENQLEGKATQGNTEENP

REAGKPKPECEVYDPNALYCICRQPHNNR - UNI29527 - RFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETNGSATDEQ

DSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQP - UNI15101 - VVEAPGAPKCIGPGCSSVAQPDSVYCSNDCILKHA

AATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQ - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 - VGIKISSVHKR

LASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKPTALSPTLLSKS - UNI14814 - - UNI15101 - - UNI15315

 - SMKDDRRVEDRTMAAVTIPKKALPSASLVGRQTSPRNLVPKKLPPYSNMAGAKPAIKKLPSGFKGTIPKRPWPSATLSGTSARQAGPTPMTAASKKL

PGSAAVVGVTRKPMSANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKR - UNI14814 - - UNI15315 - - UNI31653 - RVN

DSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQ - UNI31653 - GLFHRVLREEISLAKLVRMKPEELVSKELSMWTEK

PTKS - UNI3202 - - UNI31653 - VIESRTKLLNESKKNTTKPETIPDMEDSPPVSDSE EQQESVRAAPEKSAAPLLDVFSSMLKDTTSQHRA

HLFDLNCKICTG - UNI9454 - GQVPSSEDEPAPKKQKLSASSKKEDFKPRHDSSPPNAVPNTADEGIADTLPENASEPDPESTSSLNQERKCFPES

PGDSHPEPSSLGGLSPSSASGGSGVVTTVTMSGRDPRTALSGSCTVTASMAAHLDNSQASETKLDMIKPALTSAVVPKSILAKPSSSPDPRYLSVPPSPS

 SISESRSPPEGDTTLFLSRLNTIWKGFINMQSVAKFVTKAYPVSGCLDYLSE DLPDTIHIGGRIAPKTVWDYVGKLKSSVSK - UNI12442 - EL

CLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAKDPVPSKLLPFEGPG - UNI12280 - GLESPRPNIILGLVICQKVKRP

SSAGELDKTDEKRTRLQQEELETSVYPKVTAALPSEKKPPKYSVHSIDTAATSTTPPGSPPPPPPLPEPPVLKILSSLKPGSTSTVTAPTTAAITTTASP

VTAATSKTASPLEHILQTLFGKKKSFEPSGKESVGSTLSPHQDSKAKGEDTMSAAPLLDPIVQQFGQFSKDKALEEEEEDDRPYDPEEEYNPDRAFHTLL

AEPGRPHDVQSVSETAEREEVAYDPEDETILEEAKVTIDDLPNRMCMKVSATERPADFTTDASSASLVEQQKMLEELNKQIEEQKRQLEEQEEALRQQRA

AVGVSMAHFSVSDALMSPPPKSSLGKTELFSQEQQAPDPSQGAPNTNHNLDSRQSRDPRQARRLAAENTENESLPRAPTGSTPGPQGTLPARETPAGTAV

VQGPGLAAEAKESMAVPWAPGENAVLRPEHDIQKCEHPGNPVSLPLDTSHLPTAGDGAARPAPPRRVLLPTPPSTTFPPSFPLQPKAQNFSSGSREPFSG

PTFMSQETSLGSSQYEDPRGAQSAGKNDSPVADMEDSREPQPRPGESTTSFPQPGQRGGGPQPQFPGQREPAPRTFGMSGHHGPSFPGPRGPVPPYSEEN

LVPNSDGPRGPPPARFGAQKPPIPSLFSGQHGPPPYGDNRGLSPSYLGGPRGGAPAQFEDRKDPHGEKREFQDTPYNEMTGAPAQCEGPDQAQFMGNRAP

FQFGGQRRPLLTQMKGPRGGPPPSQFGAQRGPPPGHFVGPRGPHPSQFENSRGTHPGQFEGARGQAPGFMPGPRGIQPQQFEEQRVNSPPRFAGQRASAP

LPYGGPRGPAPFPEKNEQPPSRFHFQGPSSQPVKPPPRPLLELPSHPPQHRKDRWDEAGPATALPSSAGPGQGHEADGQWATSEFREGKGHEYRSPAFEG

RQRERFEAGSKEKPLDEPEAQGLESRQGRAFEDRRRERERGRNWSRERDWERSRDWDRHREWDKGRDRSSNRDRERDNDRAKEWDRSRERSRNRDRDRER

RRDRDRSRSRDRDRDRERARDRDRDRGRDRKDRSKSRESPRDQKPEARTSEGGPAAAQA
Transcript ENSMUST00000103056
Sequence
TCTAGCCTCGCCGTAGCTCGGTGGCCGGTCGATTTCTTCCGCTTGCCGCGCGGCCTACCACTCTAGGACGGTAGTCTCGCTGGTCTCTGCTCTATATCCG

TGGTAGCTCTGGAAATGGCTGCGGGATCCCGGCGGCCGGG - UNI22601 - - UNI29527 - GAGCTTGTTTAAGAGGCAGTCCCCACTGTCCCT

TTGGTTGTTCGAAGCTCCGGAATCTTCTCATTGATGAACTGTGACTGACAACAGTGGGGTGAGGCTTGGCCGTCTGCTTGACCTGGCCCCAGGTCTATAA

TTTTATGTAGGATTTCCAGCCAAAGGTTTCCAAGCTTTCAGTTTTGGGACAG - UNI351 - - UNI29527 - GTATGGATGATAAAGGGCACCTG

AGCAATGAGGAAGCACCCAAGGCTATCAAACCCACCAGTAAGGAGTTCAGGAAAACCTGGGGTTTTCGAAGAACCACGATTGCCAAACGTGAGGGTGCAG

GAGACACGGAGGTGGACCCCAGTGAGCAGCAACCACAGCAGCATAACCTCTCCCTGCGCCGCAGTGGACGGCAACCAAAACGTACTGAGAGGGTAGAAGA

GTTTCTTACCACGGTTCGGCGCCGAGGGAAAAAGAATGTGCCGGTGTCCCTGGAGGATTCCAGTGAGCCCACATCTTCCACAGTCACTGATGTGGAGACA

GCTTCCGAGGGGAGCGTTGAAAGCAGTTCTGAGATCAGAAGTGGCCCTGTATCTGACTCCTTAGGGAAAGAACATCCTGCCTCTTCTGAAAAGGCAAAAG

GAGGTGAAGAGGAAGAAGACACCTCTGACAGTGACAGTGATGGCCTTACGTTGAAGGAACTTCAGAACCGCCTTCGGAGAAAGCGAGAGCAAGAACCTGT

GGAGAGGTCCCTGAGAGGCAGTCAGAATCGCCTGAGGAAGAAGCGCAGAGAGGAAGATTCTGCCGAAACTGGGAGTGTCCAAATAGGCAGTGCCGAGCAG

GACAGACCTCTCTGTAAGCAGGAGCCTGAGGCTAGTCAGGGACCAGTGTCCCAGTCAGAGACAGATGACATAGAAAATCAGTTGGAAGGGAAGGCGACTC

AGGGAAATACAGAGGAAAACCCCAGGGAAGCGGGCAAACCAAAGCCTGAGTGTGAGGTTTACGACCCCAATGCCCTGTACTGCATCTGCCGCCAGCCTCA

CAACAACAG - UNI29527 - GTTTATGATCTGCTGTGATCGGTGTGAGGAGTGGTTCCATGGTGACTGTGTGGGTATTTCTGAGGCCCGAGGGCGGC

TCCTGGAAAGGAACGGGGAAGACTACATCTGCCCAAATTGCACCATTTTGCAAGTGCAGGATGAGACAAACGGTAGCGCCACCGATGAGCAGGACTCTGG

GTGCAGATCTGTGGGTGCTGATGGCACAGACTGCACAAGCATAGGGACAGTAGAGCAGAAGTCCGGAGAAGACCAGGGCATAAAGGGTAGGATTGAGAAG

GCAGCAAACCCCAGCGGCAAGAAAAAACTCAAGATATTCCAGCCT - UNI15101 - GTCGTAGAGGCTCCTGGTGCTCCTAAATGCATTGGCCCTGG

GTGTTCCAGTGTAGCACAGCCTGACTCTGTGTATTGCAGTAATGACTGCATTCTCAAACACGCAGCAGCTACCATGAGATTTCTAAGTTCAGGTAAAGAA

CAAAAAACAAAACCCAAGGAAAAGGTCAAGACGAAGCCAGAAAAGTTCAGTCTTCCAAAATGCAGTGTTCAG - UNI10154 - - UNI14814 - -

 UNI15101 - - UNI15315 - GTGGGGATTAAAATCTCTTCTGTGCACAAGAGACTAGCGTCAGAGAAAAGGGAAAACCCAGTGAAGAAAGTGATG

CTGGCTTCCAGGAGTGAGACTTCTGGGAAGGAGGCAGCCTGTGAGAGCAGCACACCATCCTGGGCAAGTGACCACAACTACAATGCTGTGAAGCCAGAGA

AGCCAGAGAAGCCCACTGCACTCTCGCCCACCCTATTGAGTAAAT - UNI14814 - - UNI15101 - - UNI15315 - CCATGAAGGATGACA

GGAGGGTGGAGGACAGGACAATGGCAGCAGTTACCATCCCGAAGAAAGCACTTCCTTCAGCCTCTTTGGTGGGCAGACAGACTTCACCTAGGAATCTTGT

TCCAAAGAAGCTTCCTCCTTACTCTAATATGGCAGGAGCCAAACCAGCCATTAAGAAACTGCCTTCAGGCTTCAAGGGTACCATCCCCAAGAGGCCATGG

CCCTCAGCCACCCTGTCAGGCACTTCTGCCAGGCAGGCAGGACCAACACCTATGACAGCTGCTTCCAAAAAGTTGCCTGGCTCTGCTGCTGTGGTGGGAG

TTACCAGGAAGCCAATGTCTGCCAATGTTCCTGCTGCTTCTCCAGCCCCAGGACGGCTTGGTCCTGTGAGCCCAGCTCCATCACAGCCCAATTCACAAAT

TCGACAAAATATAAGGCGCTCCTTGAAAGAGATTTTGTGGAAAAG - UNI14814 - - UNI15315 - - UNI31653 - AGTCAATGACAGCGA

TGACTTAATAATGACAGAAAATGAAGTAGGAAAAATTGCCCTCCACATTGAGAAGGAGATGTTTAACTTGTTCCAGGTTACTGATAATCGCTATAAGAGC

AAATATCGCAGCATCATGTTCAACCTTAAGGATCCTAAGAATCAG - UNI31653 - GGGCTCTTCCATCGTGTTCTTCGAGAAGAAATCTCCTTGGC

AAAACTTGTCAGAATGAAGCCTGAAGAACTTGTATCTAAAGAGCTTTCTATGTGGACAGAGAAGCCCACAAAATCT - UNI3202 - - UNI31653 

- GTGATAGAATCCAGGACTAAGTTGCTTAATGAAAGCAAGAAGAACACTACTAAACCAGAAACCATTCCTGACATGGAAGATTCTCCACCGGTATCAGA

TTCAGAA GAACAACAAGAGTCAGTGCGAGCCGCCCCTGAGAAGAGCGCAGCACCTCTCCTGGACGTCTTCAGCAGCATGCTGAAGGACACCACAAGCCA

GCACCGTGCCCATCTTTTTGATTTAAACTGTAAAATCTGTACAG - UNI9454 - GTCAGGTTCCATCCTCGGAGGATGAACCAGCTCCTAAGAAGCA

AAAGCTTTCAGCTTCTTCTAAGAAGGAAGACTTTAAGCCCAGGCATGACAGCTCTCCACCTAATGCAGTTCCTAACACTGCTGATGAAGGGATTGCAGAC

ACGCTGCCTGAAAATGCCTCTGAGCCAGACCCGGAGAGTACATCTAGTCTTAACCAGGAGAGAAAGTGTTTCCCTGAGTCTCCAGGCGATAGCCATCCTG

AGCCCTCGTCTCTGGGTGGCCTTTCTCCCTCTTCTGCCTCTGGTGGGAGTGGGGTGGTCACCACAGTCACCATGTCTGGTCGAGACCCCAGAACTGCCCT

GAGTGGGTCGTGCACAGTCACAGCCTCCATGGCAGCCCATCTGGACAACTCCCAGGCTTCAGAAACCAAACTGGACATGATAAAGCCTGCATTGACTTCT

GCAGTGGTGCCCAAGTCCATACTGGCTAAGCCATCCTCCTCTCCTGACCCGAGATACCTGTCAGTACCACCATCACCAAG CATTTCAGAATCACGATCC

CCACCAGAAGGAGATACAACCCTCTTTTTGTCTCGACTCAACACGATTTGGAAAGGATTTATTAATATGCAGAGTGTAGCAAAATTTGTCACTAAGGCAT

ATCCTGTCTCTGGGTGTTTGGATTATCTCAGTGAG GATTTGCCAGACACCATCCACATCGGTGGAAGGATTGCTCCAAAGACCGTGTGGGATTACGTTG

GCAAACTCAAGTCATCGGTGTCCAAG - UNI12442 - GAGCTCTGTCTGATCCGCTTCCACCCTGCCACTGAGGAGGAGGAGGTTGCATACATTTCT

CTCTACTCCTATTTTAGCAGCCGTGGTCGCTTTGGGGTTGTAGCTAATAACAACAGGCATGTCAAGGACCTGTACCTGATTCCACTGAGTGCTAAGGACC

CTGTGCCATCCAAACTCTTGCCCTTTGAGGGCCCAGGTAAGCACCCAGTTTCTGGGAGGTGA
Translation
 - UNI22601 - - UNI29527 -  - UNI351 - - UNI29527 - MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDTEVDPS

EQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTDVETASEGSVESSSEIRSGPVSDSLGKEHPASSEKAKGGEEEEDT

SDSDSDGLTLKELQNRLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGPVSQSETDDIENQLEGKATQGNTEENP

REAGKPKPECEVYDPNALYCICRQPHNNR - UNI29527 - RFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETNGSATDEQ

DSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQP - UNI15101 - VVEAPGAPKCIGPGCSSVAQPDSVYCSNDCILKHA

AATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQ - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 - VGIKISSVHKR

LASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKPTALSPTLLSKS - UNI14814 - - UNI15101 - - UNI15315

 - SMKDDRRVEDRTMAAVTIPKKALPSASLVGRQTSPRNLVPKKLPPYSNMAGAKPAIKKLPSGFKGTIPKRPWPSATLSGTSARQAGPTPMTAASKKL

PGSAAVVGVTRKPMSANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKR - UNI14814 - - UNI15315 - - UNI31653 - RVN

DSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQ - UNI31653 - GLFHRVLREEISLAKLVRMKPEELVSKELSMWTEK

PTKS - UNI3202 - - UNI31653 - VIESRTKLLNESKKNTTKPETIPDMEDSPPVSDSE EQQESVRAAPEKSAAPLLDVFSSMLKDTTSQHRA

HLFDLNCKICTG - UNI9454 - GQVPSSEDEPAPKKQKLSASSKKEDFKPRHDSSPPNAVPNTADEGIADTLPENASEPDPESTSSLNQERKCFPES

PGDSHPEPSSLGGLSPSSASGGSGVVTTVTMSGRDPRTALSGSCTVTASMAAHLDNSQASETKLDMIKPALTSAVVPKSILAKPSSSPDPRYLSVPPSPS

 SISESRSPPEGDTTLFLSRLNTIWKGFINMQSVAKFVTKAYPVSGCLDYLSE DLPDTIHIGGRIAPKTVWDYVGKLKSSVSK - UNI12442 - EL

CLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAKDPVPSKLLPFEGPGKHPVSGR
Transcript ENSMUST00000103057
Sequence
CGCTTTTGCGCAAGATGGCTGCTGCGGGGGCATTCGCGTACTGAGTGCTAGCGCGGGGATGGAGACGTGTAGACTGAGTTCGAAACGAAG - UNI6398

 - - UNI22601 - - UNI29527 - GAGCTTGTTTAAGAGGCAGTCCCCACTGTCCCTTTGGTTGTTCGAAGCTCCGGAATCTTCTCATTGATGAA

CTGTGACTGACAACAGTGGGGTGAGGCTTGGCCGTCTGCTTGACCTGGCCCCAGGTCTATAATTTTATGTAGGATTTCCAGCCAAAGGTTTCCAAGCTTT

CAGTTTTGGGACAG - UNI351 - - UNI29527 - GTATGGATGATAAAGGGCACCTGAGCAATGAGGAAGCACCCAAGGCTATCAAACCCACCAG

TAAGGAGTTCAGGAAAACCTGGGGTTTTCGAAGAACCACGATTGCCAAACGTGAGGGTGCAGGAGACACGGAGGTGGACCCCAGTGAGCAGCAACCACAG

CAGCATAACCTCTCCCTGCGCCGCAGTGGACGGCAACCAAAACGTACTGAGAGGGTAGAAGAGTTTCTTACCACGGTTCGGCGCCGAGGGAAAAAGAATG

TGCCGGTGTCCCTGGAGGATTCCAGTGAGCCCACATCTTCCACAGTCACTGATGTGGAGACAGCTTCCGAGGGGAGCGTTGAAAGCAGTTCTGAGATCAG

AAGTGGCCCTGTATCTGACTCCTTAGGGAAAGAACATCCTGCCTCTTCTGAAAAGGCAAAAGGAGGTGAAGAGGAAGAAGACACCTCTGACAGTGACAGT

GATGGCCTTACGTTGAAGGAACTTCAGAACCGCCTTCGGAGAAAGCGAGAGCAAGAACCTGTGGAGAGGTCCCTGAGAGGCAGTCAGAATCGCCTGAGGA

AGAAGCGCAGAGAGGAAGATTCTGCCGAAACTGGGAGTGTCCAAATAGGCAGTGCCGAGCAGGACAGACCTCTCTGTAAGCAGGAGCCTGAGGCTAGTCA

GGGACCAGTGTCCCAGTCAGAGACAGATGACATAGAAAATCAGTTGGAAGGGAAGGCGACTCAGGGAAATACAGAGGAAAACCCCAGGGAAGCGGGCAAA

CCAAAGCCTGAGTGTGAGGTTTACGACCCCAATGCCCTGTACTGCATCTGCCGCCAGCCTCACAACAACAG - UNI29527 - GTTTATGATCTGCTG

TGATCGGTGTGAGGAGTGGTTCCATGGTGACTGTGTGGGTATTTCTGAGGCCCGAGGGCGGCTCCTGGAAAGGAACGGGGAAGACTACATCTGCCCAAAT

TGCACCATTTTGCAAGTGCAGGATGAGACAAACGGTAGCGCCACCGATGAGCAGGACTCTGGGTGCAGATCTGTGGGTGCTGATGGCACAGACTGCACAA

GCATAGGGACAGTAGAGCAGAAGTCCGGAGAAGACCAGGGCATAAAGGGTAGGATTGAGAAGGCAGCAAACCCCAGCGGCAAGAAAAAACTCAAGATATT

CCAGCCT - UNI15101 - GTCGTAGAGGCTCCTGGTGCTCCTAAATGCATTGGCCCTGGGTGTTCCAGTGTAGCACAGCCTGACTCTGTGTATTGCA

GTAATGACTGCATTCTCAAACACGCAGCAGCTACCATGAGATTTCTAAGTTCAGGTAAAGAACAAAAAACAAAACCCAAGGAAAAGGTCAAGACGAAGCC

AGAAAAGTTCAGTCTTCCAAAATGCAGTGTTCAG - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 - GTGGGGATTAAAA

TCTCTTCTGTGCACAAGAGACTAGCGTCAGAGAAAAGGGAAAACCCAGTGAAGAAAGTGATGCTGGCTTCCAGGAGTGAGACTTCTGGGAAGGAGGCAGC

CTGTGAGAGCAGCACACCATCCTGGGCAAGTGACCACAACTACAATGCTGTGAAGCCAGAGAAGCCAGAGAAGCCCACTGCACTCTCGCCCACCCTATTG

AGTAAAT - UNI14814 - - UNI15101 - - UNI15315 - CCATGAAGGATGACAGGAGGGTGGAGGACAGGACAATGGCAGCAGTTACCATC

CCGAAGAAAGCACTTCCTTCAGCCTCTTTGGTGGGCAGACAGACTTCACCTAGGAATCTTGTTCCAAAGAAGCTTCCTCCTTACTCTAATATGGCAGGAG

CCAAACCAGCCATTAAGAAACTGCCTTCAGGCTTCAAGGGTACCATCCCCAAGAGGCCATGGCCCTCAGCCACCCTGTCAGGCACTTCTGCCAGGCAGGC

AGGACCAACACCTATGACAGCTGCTTCCAAAAAGTTGCCTGGCTCTGCTGCTGTGGTGGGAGTTACCAGGAAGCCAATGTCTGCCAATGTTCCTGCTGCT

TCTCCAGCCCCAGGACGGCTTGGTCCTGTGAGCCCAGCTCCATCACAGCCCAATTCACAAATTCGACAAAATATAAGGCGCTCCTTGAAAGAGATTTTGT

GGAAAAG - UNI14814 - - UNI15315 - - UNI31653 - AGTCAATGACAGCGATGACTTAATAATGACAGAAAATGAAGTAGGAAAAATTG

CCCTCCACATTGAGAAGGAGATGTTTAACTTGTTCCAGGTTACTGATAATCGCTATAAGAGCAAATATCGCAGCATCATGTTCAACCTTAAGGATCCTAA

GAATCAG - UNI31653 - GGGCTCTTCCATCGTGTTCTTCGAGAAGAAATCTCCTTGGCAAAACTTGTCAGAATGAAGCCTGAAGAACTTGTATCTA

AAGAGCTTTCTATGTGGACAGAGAAGCCCACAAAATCT - UNI3202 - - UNI31653 - GTGATAGAATCCAGGACTAAGTTGCTTAATGAAAGC

AAGAAGAACACTACTAAACCAGAAACCATTCCTGACATGGAAGATTCTCCACCGGTATCAGATTCAGAA GAACAACAAGAGTCAGTGCGAGCCGCCCCT

GAGAAGAGCGCAGCACCTCTCCTGGACGTCTTCAGCAGCATGCTGAAGGACACCACAAGCCAGCACCGTGCCCATCTTTTTGATTTAAACTGTAAAATCT

GTACAG - UNI9454 - GTCAGGTTCCATCCTCGGAGGATGAACCAGCTCCTAAGAAGCAAAAGCTTTCAGCTTCTTCTAAGAAGGAAGACTTTAAGC

CCAGGCATGACAGCTCTCCACCTAATGCAGTTCCTAACACTGCTGATGAAGGGATTGCAGACACGCTGCCTGAAAATGCCTCTGAGCCAGACCCGGAGAG

TACATCTAGTCTTAACCAGGAGAGAAAGTGTTTCCCTGAGTCTCCAGGCGATAGCCATCCTGAGCCCTCGTCTCTGGGTGGCCTTTCTCCCTCTTCTGCC

TCTGGTGGGAGTGGGGTGGTCACCACAGTCACCATGTCTGGTCGAGACCCCAGAACTGCCCTGAGTGGGTCGTGCACAGTCACAGCCTCCATGGCAGCCC

ATCTGGACAACTCCCAGGCTTCAGAAACCAAACTGGACATGATAAAGCCTGCATTGACTTCTGCAGTGGTGCCCAAGTCCATACTGGCTAAGCCATCCTC

CTCTCCTGACCCGAGATACCTGTCAGTACCACCATCACCAAG CATTTCAGAATCACGATCCCCACCAGAAGGAGATACAACCCTCTTTTTGTCTCGACT

CAACACGATTTGGAAAGGATTTATTAATATGCAGAGTGTAGCAAAATTTGTCACTAAGGCATATCCTGTCTCTGGGTGTTTGGATTATCTCAGTGAG GA

TTTGCCAGACACCATCCACATCGGTGGAAGGATTGCTCCAAAGACCGTGTGGGATTACGTTGGCAAACTCAAGTCATCGGTGTCCAAG - UNI12442 

- GAGCTCTGTCTGATCCGCTTCCACCCTGCCACTGAGGAGGAGGAGGTTGCATACATTTCTCTCTACTCCTATTTTAGCAGCCGTGGTCGCTTTGGGGT

TGTAGCTAATAACAACAGGCATGTCAAGGACCTGTACCTGATTCCACTGAGTGCTAAGGACCCTGTGCCATCCAAACTCTTGCCCTTTGAGGGCCCAGGT

AAGCACCCAGTTTCTGGGAGGTGATTAGGTCCACCCAGTCCCCACGCAGCCCTCTTCACTGACATAGTCCTCCCAGGTTGTCACAGGAACCTTGGCCTCC

TGACCCAAAATCCCAGGAACTAAATTAGGATGACCAGTGAGTGGAATCATGTATGTATGGAGAATCCATTCTCTGAAATTTTAGACACATAGCTCTAAAA

GTATCTCAGTTCGTATGAAAATTGGCTCCCTGCTTATAATCAAATTTTTTGCTGCTTCAAACCAGAGAGCTGTTCAAATGTCAGGACTAAGAACCAAACT

TAGAGAGGAGAGACAGGGCCTACCTGGATCCAGGGGTGCCTTCTACTCCAGAAAGTAGGTTGCTATTATTGTTGCCACTCTACTCAAAGTGAGTTGGCCT

CTTTCATTCCAAGGGACTTCTCCACAGGACTTGATTCCTAAGGAGTTCAGTAGCAGTGCCATAGAAAAGCATCCTAAAATGACTGCTTTTCAGTCACTGC

ACATATTGTAAGTTCTTTCATCTTTTGGATACTACTTAGATTTGCTCTTTCCTTGGAAGTATTGTTTAACCCATTACATACAAAGACACACAAGGTGGGG

TCCAGATGACACAGAGGGCTTGGTCTGAGGTGTGTGGTCCTGCTGAGCGCCATCGAGGTGTCCTGTGGCCTCACTTAGACCATTGGTACTAGGGGCCTGA

AATGGTCACTTCTGTCATGTTCCCAGAGGATTAATCTTACTAGCCAATGGGTTTGACATGTGCTAAATATTCTTGAACATGCTGTCATAGAAGTAGCTCC

TGAATACCCCAAGGCCTGTACTCCACACCACTTGGACTACATACACCTAAACTGGCTAAGATGCTGAAGCCCAAGCCCAGTGCCCCAATCACAGCCCTCT

ACCAACTACAGACTGCTCCTAGTTCATGGCATGGCTTTACCTTTGCCTGCAGCTACACAGTATGTGTACATTAAGTGTTGGTTTGTGTCATAATGCTGGG

TTAAATGTTAGTGGTATGATGCACTAGATGATTTTAGTGCCCAGCACATTTCAAAAGTAAAGTCTGTTAGTATGTTCTGTGAAGCCATAATCGGGATATA

G
Translation
 - UNI6398 - - UNI22601 - - UNI29527 -  - UNI351 - - UNI29527 - MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAK

REGAGDTEVDPSEQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTDVETASEGSVESSSEIRSGPVSDSLGKEHPASS

EKAKGGEEEEDTSDSDSDGLTLKELQNRLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGPVSQSETDDIENQLE

GKATQGNTEENPREAGKPKPECEVYDPNALYCICRQPHNNR - UNI29527 - RFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQV

QDETNGSATDEQDSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQP - UNI15101 - VVEAPGAPKCIGPGCSSVAQPDS

VYCSNDCILKHAAATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQ - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 -

 VGIKISSVHKRLASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKPTALSPTLLSKS - UNI14814 - - UNI15101 

- - UNI15315 - SMKDDRRVEDRTMAAVTIPKKALPSASLVGRQTSPRNLVPKKLPPYSNMAGAKPAIKKLPSGFKGTIPKRPWPSATLSGTSARQA

GPTPMTAASKKLPGSAAVVGVTRKPMSANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKR - UNI14814 - - UNI15315 - - UN

I31653 - RVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQ - UNI31653 - GLFHRVLREEISLAKLVRMKPEE

LVSKELSMWTEKPTKS - UNI3202 - - UNI31653 - VIESRTKLLNESKKNTTKPETIPDMEDSPPVSDSE EQQESVRAAPEKSAAPLLDVFS

SMLKDTTSQHRAHLFDLNCKICTG - UNI9454 - GQVPSSEDEPAPKKQKLSASSKKEDFKPRHDSSPPNAVPNTADEGIADTLPENASEPDPESTS

SLNQERKCFPESPGDSHPEPSSLGGLSPSSASGGSGVVTTVTMSGRDPRTALSGSCTVTASMAAHLDNSQASETKLDMIKPALTSAVVPKSILAKPSSSP

DPRYLSVPPSPS SISESRSPPEGDTTLFLSRLNTIWKGFINMQSVAKFVTKAYPVSGCLDYLSE DLPDTIHIGGRIAPKTVWDYVGKLKSSVSK - U

NI12442 - ELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAKDPVPSKLLPFEGPGKHPVSGR
Transcript ENSMUST00000037764
Sequence
GGCGCACGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTCTGAATTCGAGGCCAGCCTGGTCTACAAAGTGAGCTCCAGGACAGCCAGGG

CTATACAGAGAAACCCTGTCTCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAACCCAAAAGGTTTTTAAAAGTTCACACAAAAACACCTTGTCTTGTCAA

TGAAAATGATCCTGTAAATCTGTCCTATTTTGATGGCAAGTTTGTCGTTTATTTTTACAAATTAACTAGTGATTAATTGGAGCTTTTGATAATAGGCTTG

TTTGAAGTAAAAGGTTTTAATGTAATACATGAAGTGTTTTTCTTTTTAAAATGAGGAGTAATTATCACCATAAAATACTGTGGAGCCAACCTCTCTTCGG

TTCGAAATTTTAAAACCTGCAAATGCACCTAATTCCTTGGTTGTACGGGCTATTTCCAGGGTGGAAATGGTATAATGTCAGCATGCTATTCTGTATGTGT

TGCTCAGTGTGTGCGTTCTGCTTTCCAGCCATGAAGGATGACAGGAGGGTGGAGGACAGGACAATGGCAGCAGTTACCATCCCGAAGAAAGCACTTCCTT

CAGCCTCTTTGGTGGGCAGACAGACTTCACCTAGGAATCTTGTTCCAAAGAAGCTTCCTCCTTACTCTAATATGGCAGGAGCCAAACCAGCCATTAAGAA

ACTGCCTTCAGGCTTCAAGGGTACCATCCCCAAGAGGCCATGGCCCTCAGCCACCCTGTCAGGCACTTCTGCCAGGCAGGCAGGACCAACACCTATGACA

GCTGCTTCCAAAAAGTTGCCTGGCTCTGCTGCTGTGGTGGGAGTTACCAGGAAGCCAATGTCTGCCAATGTTCCTGCTGCTTCTCCAGCCCCAGGACGGC

TTGGTCCTGTGAGCCCAGCTCCATCACAGCCCAATTCACAAATTCGACAAAATATAAGGCGCTCCTTGAAAGAGATTTTGTGGAAAAG - UNI14814 

- - UNI15315 - - UNI31653 - AGTCAATGACAGCGATGACTTAATAATGACAGAAAATGAAGTAGGAAAAATTGCCCTCCACATTGAGAAGGA

GATGTTTAACTTGTTCCAGGTTACTGATAATCGCTATAAGAGCAAATATCGCAGCATCATGTTCAACCTTAAGGATCCTAAGAATCAG - UNI31653 

- GGGCTCTTCCATCGTGTTCTTCGAGAAGAAATCTCCTTGGCAAAACTTGTCAGAATGAAGCCTGAAGAACTTGTATCTAAAGAGCTTTCTATGTGGAC

AGAGAAGCCCACAAAATCT - UNI3202 - - UNI31653 - GTGATAGAATCCAGGACTAAGTTGCTTAATGAAAGCAAGAAGAACACTACTAAAC

CAGAAACCATTCCTGACATGGAAGATTCTCCACCGGTATCAGATTCAGAA GAACAACAAGAGTCAGTGCGAGCCGCCCCTGAGAAGAGCGCAGCACCTC

TCCTGGACGTCTTCAGCAGCATGCTGAAGGACACCACAAGCCAGCACCGTGCCCATCTTTTTGATTTAAACTGTAAAATCTGTACAG - UNI9454 - 

GTCAGGTTCCATCCTCGGAGGATGAACCAGCTCCTAAGAAGCAAAAGCTTTCAGCTTCTTCTAAGAAGGAAGACTTTAAGCCCAGGCATGACAGCTCTCC

ACCTAATGCAGTTCCTAACACTGCTGATGAAGGGATTGCAGACACGCTGCCTGAAAATGCCTCTGAGCCAGACCCGGAGAGTACATCTAGTCTTAACCAG

GAGAGAAAGTGTTTCCCTGAGTCTCCAGGCGATAGCCATCCTGAGCCCTCGTCTCTGGGTGGCCTTTCTCCCTCTTCTGCCTCTGGTGGGAGTGGGGTGG

TCACCACAGTCACCATGTCTGGTCGAGACCCCAGAACTGCCCTGAGTGGGTCGTGCACAGTCACAGCCTCCATGGCAGCCCATCTGGACAACTCCCAGGC

TTCAGAAACCAAACTGGACATGATAAAGCCTGCATTGACTTCTGCAGTGGTGCCCAAGTCCATACTGGCTAAGCCATCCTCCTCTCCTGACCCGAGATAC

CTGTCAGTACCACCATCACCAAG CATTTCAGAATCACGATCCCCACCAGAAGGAGATACAACCCTCTTTTTGTCTCGACTCAACACGATTTGGAAAGGA

TTTATTAATATGCAGAGTGTAGCAAAATTTGTCACTAAGGCATATCCTGTCTCTGGGTGTTTGGATTATCTCAGTGAG GATTTGCCAGACACCATCCAC

ATCGGTGGAAGGATTGCTCCAAAGACCGTGTGGGATTACGTTGGCAAACTCAAGTCATCGGTGTCCAAG - UNI12442 - GAGCTCTGTCTGATCCG

CTTCCACCCTGCCACTGAGGAGGAGGAGGTTGCATACATTTCTCTCTACTCCTATTTTAGCAGCCGTGGTCGCTTTGGGGTTGTAGCTAATAACAACAGG

CATGTCAAGGACCTGTACCTGATTCCACTGAGTGCTAAGGACCCTGTGCCATCCAAACTCTTGCCCTTTGAGGGCCCAGGTAAGCACCCAGTTTCTGGGA

GGTGATTAGGTCCACCCAGTCCCCACGCAGCCCTCTTCACTGACATAGTCCTCCCAGGTTGTCACAGGAACCTTGGCCTCCTGACCCAAAATCCCAGGAA

CTAAATTAGGATGACCAGTGAGTGGAATCATGTATGTATGGAGAATCCATTCTCTGAAATTTTAGACACATAGCTCTAAAAGTATCTCAGTTCGTATGAA

AATTGGCTCCCTGCTTATAATCAAATTTTTTGCTGCTTCAAACCAGAGAGCTGTTCAAATGTCAGGACTAAGAACCAAACTTAGAGAGGAGAGACAGGGC

CTACCTGGATCCAGGGGTGCCTTCTACTCCAGAAAGTAGGTTGCTATTATTGTTGCCACTCTACTCAAAGTGAGTTGGCCTCTTTCATTCCAAGGGACTT

CTCCACAGGACTTGATTCCTAAGGAGTTCAGTAGCAGTGCCATAGAAAAGCATCCTAAAATGACTGCTTTTCAGTCACTGCACATATTGTAAGTTCTTTC

ATCTTTTGGATACTACTTAGATTTGCTCTTTCCTTGGAAGTATTGTTTAACCCATTACATACAAAGACACACAAGGTGGGGTCCAGATGACACAGAGGGC

TTGGTCTGAGGTGTGTGGTCCTGCTGAGCGCCATCGAGGTGTCCTGTGGCCTCACTTAGACCATTGGTACTAGGGGCCTGAAATGGTCACTTCTGTCATG

TTCCCAGAGGATTAATCTTACTAGCCAATGGGTTTGACATGTGCTAAATATTCTTGAACATGCTGTCATAGAAGTAGCTCCTGAATACCCCAAGGCCTGT

ACTCCACACCACTTGGACTACATACACCTAAACTGGCTAAGATGCTGAAGCCCAAGCCCAGTGCCCCAATCACAGCCCTCTACCAACTACAGACTGCTCC

TAGTTCATGGCATGGCTTTACCTTTGCCTGCAGCTACACAGTATGTGTACATTAAGTGTTGGTTTGTGTCATAATGCTGGGTTAAATGTTAGTGGTATGA

TGCACTAGATGATTTTAGTGCCCAGCACATTTCAAAAGTAAAGTCTGTTAGTATGTTCTGTGAAGCCATAATCGGGATAT
Translation
MAAVTIPKKALPSASLVGRQTSPRNLVPKKLPPYSNMAGAKPAIKKLPSGFKGTIPKRPWPSATLSGTSARQAGPTPMTAASKKLPGSAAVVGVTRKPMS

ANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKR - UNI14814 - - UNI15315 - - UNI31653 - RVNDSDDLIMTENEVGKI

ALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQ - UNI31653 - GLFHRVLREEISLAKLVRMKPEELVSKELSMWTEKPTKS - UNI3202 

- - UNI31653 - VIESRTKLLNESKKNTTKPETIPDMEDSPPVSDSE EQQESVRAAPEKSAAPLLDVFSSMLKDTTSQHRAHLFDLNCKICTG - 

UNI9454 - GQVPSSEDEPAPKKQKLSASSKKEDFKPRHDSSPPNAVPNTADEGIADTLPENASEPDPESTSSLNQERKCFPESPGDSHPEPSSLGGLS

PSSASGGSGVVTTVTMSGRDPRTALSGSCTVTASMAAHLDNSQASETKLDMIKPALTSAVVPKSILAKPSSSPDPRYLSVPPSPS SISESRSPPEGDTT

LFLSRLNTIWKGFINMQSVAKFVTKAYPVSGCLDYLSE DLPDTIHIGGRIAPKTVWDYVGKLKSSVSK - UNI12442 - ELCLIRFHPATEEEEVA

YISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAKDPVPSKLLPFEGPGKHPVSGR
Transcript ENSMUST00000103054
Sequence
TCTAGCCTCGCCGTAGCTCGGTGGCCGGTCGATTTCTTCCGCTTGCCGCGCGGCCTACCACTCTAGGACGGTAGTCTCGCTGGTCTCTGCTCTATATCCG

TGGTAGCTCTGGAAATGGCTGCGGGATCCCGGCGGCCGGG - UNI22601 - - UNI29527 - GAGCTTGTTTAAGAGGCAGTCCCCACTGTCCCT

TTGGTTGTTCGAAGCTCCGGAATCTTCTCATTGATGAACTGTGACTGACAACAGTGGGGTGAGGCTTGGCCGTCTGCTTGACCTGGCCCCAGGTCTATAA

TTTTATGTAGGATTTCCAGCCAAAGGTTTCCAAGCTTTCAGTTTTGGGACAG - UNI351 - - UNI29527 - GTATGGATGATAAAGGGCACCTG

AGCAATGAGGAAGCACCCAAGGCTATCAAACCCACCAGTAAGGAGTTCAGGAAAACCTGGGGTTTTCGAAGAACCACGATTGCCAAACGTGAGGGTGCAG

GAGACACGGAGGTGGACCCCAGTGAGCAGCAACCACAGCAGCATAACCTCTCCCTGCGCCGCAGTGGACGGCAACCAAAACGTACTGAGAGGGTAGAAGA

GTTTCTTACCACGGTTCGGCGCCGAGGGAAAAAGAATGTGCCGGTGTCCCTGGAGGATTCCAGTGAGCCCACATCTTCCACAGTCACTGATGTGGAGACA

GCTTCCGAGGGGAGCGTTGAAAGCAGTTCTGAGATCAGAAGTGGCCCTGTATCTGACTCCTTAGGGAAAGAACATCCTGCCTCTTCTGAAAAGGCAAAAG

GAGGTGAAGAGGAAGAAGACACCTCTGACAGTGACAGTGATGGCCTTACGTTGAAGGAACTTCAGAACCGCCTTCGGAGAAAGCGAGAGCAAGAACCTGT

GGAGAGGTCCCTGAGAGGCAGTCAGAATCGCCTGAGGAAGAAGCGCAGAGAGGAAGATTCTGCCGAAACTGGGAGTGTCCAAATAGGCAGTGCCGAGCAG

GACAGACCTCTCTGTAAGCAGGAGCCTGAGGCTAGTCAGGGACCAGTGTCCCAGTCAGAGACAGATGACATAGAAAATCAGTTGGAAGGGAAGGCGACTC

AGGGAAATACAGAGGAAAACCCCAGGGAAGCGGGCAAACCAAAGCCTGAGTGTGAGGTTTACGACCCCAATGCCCTGTACTGCATCTGCCGCCAGCCTCA

CAACAACAG - UNI29527 - GTTTATGATCTGCTGTGATCGGTGTGAGGAGTGGTTCCATGGTGACTGTGTGGGTATTTCTGAGGCCCGAGGGCGGC

TCCTGGAAAGGAACGGGGAAGACTACATCTGCCCAAATTGCACCATTTTGCAAGTGCAGGATGAGACAAACGGTAGCGCCACCGATGAGCAGGACTCTGG

GTGCAGATCTGTGGGTGCTGATGGCACAGACTGCACAAGCATAGGGACAGTAGAGCAGAAGTCCGGAGAAGACCAGGGCATAAAGGGTAGGATTGAGAAG

GCAGCAAACCCCAGCGGCAAGAAAAAACTCAAGATATTCCAGCCT - UNI15101 - GTCGTAGAGGCTCCTGGTGCTCCTAAATGCATTGGCCCTGG

GTGTTCCAGTGTAGCACAGCCTGACTCTGTGTATTGCAGTAATGACTGCATTCTCAAACACGCAGCAGCTACCATGAGATTTCTAAGTTCAGGTAAAGAA

CAAAAAACAAAACCCAAGGAAAAGGTCAAGACGAAGCCAGAAAAGTTCAGTCTTCCAAAATGCAGTGTTCAG - UNI10154 - - UNI14814 - -

 UNI15101 - - UNI15315 - GTGGGGATTAAAATCTCTTCTGTGCACAAGAGACTAGCGTCAGAGAAAAGGGAAAACCCAGTGAAGAAAGTGATG

CTGGCTTCCAGGAGTGAGACTTCTGGGAAGGAGGCAGCCTGTGAGAGCAGCACACCATCCTGGGCAAGTGACCACAACTACAATGCTGTGAAGCCAGAGA

AGCCAGAGAAGCCCACTGCACTCTCGCCCACCCTATTGAGTAAATGTACGTATCACCCAAAGGCTGGCTTCCCAGGCCCCTCCCATCATCTGGGTGGCTG

CCTGGGGCTGTCTAGGACCAGAGTCCTGGGTGTTCTGGTGCTGATAGTAGCCAGCAGCTCACTGCCAGCCAGAAGCAGATACCAAGATGCCTCTGGACCC

CAGGTGTTCCTGCCTAGCCTGTGGAGCCTCTCTGGGTGGTTCCTAAAGAGCTGTGTAGGCCTCATGTTGGAGGCAATTTCTTATTTCAGTTTTAGGCCTT

GGTAA
Translation
 - UNI22601 - - UNI29527 -  - UNI351 - - UNI29527 - MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDTEVDPS

EQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTDVETASEGSVESSSEIRSGPVSDSLGKEHPASSEKAKGGEEEEDT

SDSDSDGLTLKELQNRLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGPVSQSETDDIENQLEGKATQGNTEENP

REAGKPKPECEVYDPNALYCICRQPHNNR - UNI29527 - RFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETNGSATDEQ

DSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQP - UNI15101 - VVEAPGAPKCIGPGCSSVAQPDSVYCSNDCILKHA

AATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQ - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 - VGIKISSVHKR

LASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKPTALSPTLLSKCTYHPKAGFPGPSHHLGGCLGLSRTRVLGVLVLIVASS

SLPARSRYQDASGPQVFLPSLWSLSGWFLKSCVGLMLEAISYFSFRPW
Transcript ENSMUST00000103055
Sequence
CGCTTTTGCGCAAGATGGCTGCTGCGGGGGCATTCGCGTACTGAGTGCTAGCGCGGGGATGGAGACGTGTAGACTGAGTTCGAAACGAAG - UNI6398

 - - UNI22601 - - UNI29527 - GAGCTTGTTTAAGAGGCAGTCCCCACTGTCCCTTTGGTTGTTCGAAGCTCCGGAATCTTCTCATTGATGAA

CTGTGACTGACAACAGTGGGGTGAGGCTTGGCCGTCTGCTTGACCTGGCCCCAGGTCTATAATTTTATGTAGGATTTCCAGCCAAAGGTTTCCAAGCTTT

CAGTTTTGGGACAG - UNI351 - - UNI29527 - GTATGGATGATAAAGGGCACCTGAGCAATGAGGAAGCACCCAAGGCTATCAAACCCACCAG

TAAGGAGTTCAGGAAAACCTGGGGTTTTCGAAGAACCACGATTGCCAAACGTGAGGGTGCAGGAGACACGGAGGTGGACCCCAGTGAGCAGCAACCACAG

CAGCATAACCTCTCCCTGCGCCGCAGTGGACGGCAACCAAAACGTACTGAGAGGGTAGAAGAGTTTCTTACCACGGTTCGGCGCCGAGGGAAAAAGAATG

TGCCGGTGTCCCTGGAGGATTCCAGTGAGCCCACATCTTCCACAGTCACTGATGTGGAGACAGCTTCCGAGGGGAGCGTTGAAAGCAGTTCTGAGATCAG

AAGTGGCCCTGTATCTGACTCCTTAGGGAAAGAACATCCTGCCTCTTCTGAAAAGGCAAAAGGAGGTGAAGAGGAAGAAGACACCTCTGACAGTGACAGT

GATGGCCTTACGTTGAAGGAACTTCAGAACCGCCTTCGGAGAAAGCGAGAGCAAGAACCTGTGGAGAGGTCCCTGAGAGGCAGTCAGAATCGCCTGAGGA

AGAAGCGCAGAGAGGAAGATTCTGCCGAAACTGGGAGTGTCCAAATAGGCAGTGCCGAGCAGGACAGACCTCTCTGTAAGCAGGAGCCTGAGGCTAGTCA

GGGACCAGTGTCCCAGTCAGAGACAGATGACATAGAAAATCAGTTGGAAGGGAAGGCGACTCAGGGAAATACAGAGGAAAACCCCAGGGAAGCGGGCAAA

CCAAAGCCTGAGTGTGAGGTTTACGACCCCAATGCCCTGTACTGCATCTGCCGCCAGCCTCACAACAACAG - UNI29527 - GTTTATGATCTGCTG

TGATCGGTGTGAGGAGTGGTTCCATGGTGACTGTGTGGGTATTTCTGAGGCCCGAGGGCGGCTCCTGGAAAGGAACGGGGAAGACTACATCTGCCCAAAT

TGCACCATTTTGCAAGTGCAGGATGAGACAAACGGTAGCGCCACCGATGAGCAGGACTCTGGGTGCAGATCTGTGGGTGCTGATGGCACAGACTGCACAA

GCATAGGGACAGTAGAGCAGAAGTCCGGAGAAGACCAGGGCATAAAGGGTAGGATTGAGAAGGCAGCAAACCCCAGCGGCAAGAAAAAACTCAAGATATT

CCAGCCT - UNI15101 - GTCGTAGAGGCTCCTGGTGCTCCTAAATGCATTGGCCCTGGGTGTTCCAGTGTAGCACAGCCTGACTCTGTGTATTGCA

GTAATGACTGCATTCTCAAACACGCAGCAGCTACCATGAGATTTCTAAGTTCAGGTAAAGAACAAAAAACAAAACCCAAGGAAAAGGTCAAGACGAAGCC

AGAAAAGTTCAGTCTTCCAAAATGCAGTGTTCAG - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 - GTGGGGATTAAAA

TCTCTTCTGTGCACAAGAGACTAGCGTCAGAGAAAAGGGAAAACCCAGTGAAGAAAGTGATGCTGGCTTCCAGGAGTGAGACTTCTGGGAAGGAGGCAGC

CTGTGAGAGCAGCACACCATCCTGGGCAAGTGACCACAACTACAATGCTGTGAAGCCAGAGAAGCCAGAGAAGCCCACTGCACTCTCGCCCACCCTATTG

AGTAAATGTACGTATCACCCAAAGGCTGGCTTCCCAGGCCCCTCCCATCATCTGGGTGGCTGCCTGGGGCTGTCTAGGACCAGAGTCCTGGGTGTTCTGG

TGCTGATAGTAGCCAGCAGCTCACTGCCAGCCAGAAGCAGATACCAAGATGCCTCTGGACCCCAGGTGTTCCTGCCTAGCCTGTGGAGCCTCTCTGGGTG

GTTCCTAAAGAGCTGTGTAGGCCTCATGTTGGAGGCAATTTCTTATTTCAGTTTTAGGCCTTGGTAAGTATTTGAACTGCTCTCAACAAGATGGGACAAC

ATCAGTGCACTGTTCAGACTCAGTTCAGACTTGAGTTCCTCACAGGACAGCCCAGCACAAACCATGAGTTTTCCCACGTTACCTATTTTCTTCACATGGT

CACCACTGCTCTTCTATAGAAAAGTGATTTTTTTCATGAGTTAGGGCATTTTTGAAAGGACAGGTAGACAATTTGTGTCTATTTCACATACTACACACCT

ACATAAACAGGTTTGAATTTTGAAGGTCATCTGCTGCTCAGATCCCATGGTGAGTAATCGTGCTGACCATACACCTACAGCAGTATTCTCATCAAAGTGA

GAATTGTGGGTGGTAGCTTCCAGACTCGTAGATGCCCCAGATTTCAAATCAGTGTTTATAGTTTGAGTAAACTTTTGAAACCCAAGATTAGATCACTGAG

TTTGGAGCCATTCTTGTTTCACTGCTGTACAAGGTACACCTTTCTTACTTTTTGTACAGTGGTTTCAAGTGAATTTTCATCTGTGTTCTCATGATAGTGT

TTTGTTCCATCTCTGTCCACCCTCAGCCCCAGATAAGGGGGTCTCATGGCCTAGGCTGGCCTTAAATTTTCTGTAAAGTTGGGGGTCCTCCTGCCCCCAC

CTGTAAAGAGTGCTGAAACTTACAGGCACACACCTGATGTATGTTGTGGGGTGTGAACTCAGAGTGTTGGACCAGCAGTCTACCAGCTGAGCTGCAGTTC

TAGCCATGGTAACTGAAACTGCTGATCTTCTTGTCTTTGTTTCCTTTGTGCTGGGATTACAGGCATGTGGTGCTGGGGATCAAACCCAGAACTTCATGCA

TTGGAGCGCTACTGACAGCTACGCCCCACCCCATTAGTGCATTTTATATCTATCTTTCTTTCTTTTTTTTTTTTTTTTTTAAGCATCACAGGGGTAAAGA

GAACTGAATCGTAATAATATGAACATGGCACATTCTTGTTAGCCTTTCAGCAAGTTAACTAGGGGAGGACCTTTTGCACGTAGGTTTACAAAGTGAGAAT

GCAGTTGTGCGTGGTATTGCAGGCCTAGACTAACATTAGAGAAGTTGAGACAGGAACATCGTGAGTTCTAGGCCAGCTGGGGTTGCAGAGTAAGAACCTT

TCTCTAGGGCAAGTGGGAGGGAATGTAAAAGACCTAAGAAATGCAGTAAATTAGCATGCTCTACTGCATTGTGGCAGGCCTTAGTGCGCTGTAGGCAGTT

GAGTAGTTTGAGATGAGAGGTCTGGTGTTCCTTCAGTTACAGCAGCTCTACAACAGCAGCATTGTGAACTAATTAATGAGTAGACTTAGAGCCAAGTACA

CCTCTTAGAATAGGGAAAAACCTGCCAAGTATAGGGTTCAAGTGCTTTAAGTGTCTGTAGACCTAACAATAAACGATAGAAACCCGGGAGTGTAGTCATA

TCCCTGAGAGCTGAAGATTGATTACAACTCAGTTCATCTTCATCTGTGTGCCCAGAATGGAAAACCAGCTCTTGAAGTTCTGATTCAGGGTCTCACATTA

GAAGCAGTTAAAAATCTCTAGTTTCAGTTTCAGACCCTGGTAAGTATATCCCTCGTGTGGCATCATAAAAAGTCCCGTGCACTGGAGGATTGGTGAGGAG

GATGGAACATAGTGGGCCTAAAATCTGAGTACTGTCTTCTGTCTCCCTTCCATGAGGAGGGGGGAGGGGGAGTCCCCCAGGGGGTCAACAAGGCGACCAG

TTCTTATGCTCAGGGGTTCTTTGACCTTTCTCTCCCCCACCTTGTCCTTCACAATTGACTCAATCCTTAGTGGAGGTGGAACTGATGGGTTTCAGGGCAG

GAGGGTAGGACAAGTTAACAATTGATTAATCTTCCCAGCATACCAGCATCTCAAAAATGATCAGCATTCAAAATACAGCATGCATCAGGGACATGTTTCT

AGACCAGTTTCTTCTGACCCCCCCCCCCCCCCATCCCATAAATGATATCATCCTAACATTGAGAGTGTCGTCATCAGTGAGGAGCAGTGTCTCCTCTCTG

CCTCTTGCTATCCAAATGGGACCAGTCCCCTTTGATCCCTCTTCCTCTGCACAGTGGGAGGGCACCACACAGTCTATGCAACTGTGTCCCAAGGACTCTG

GCCCTGTCTCCCCACTGCCTGTGTGCAGAATACACAACAGGGGAGGGGAGGGAGGGAAGCTCAAAGTGAAGCCAGTGCTGGAAACACTTCTACATTCTTC

GTGGATGCTCACCATGTACACTGAGAAGACTGCATGGCAGAGCTGAGCTGAGCTGCTGCCCCTCTGAGTGGATACAGGCAGGCAGCATGCTGCTCTGCAC

AGGAAACCACTCCTCCACATGCAGGTGATTCGATTTCACAAACAGTTGTTCCCCTGATTTATATATTTTTTCTTTCTAGAATATCTGTACAGTTTCCTTA

ATTTATAGAAACAATTGTCATTTTTAAAATTTCCAAAGATTCTGATATCGCTGTTACA
Translation
 - UNI6398 - - UNI22601 - - UNI29527 -  - UNI351 - - UNI29527 - MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAK

REGAGDTEVDPSEQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTDVETASEGSVESSSEIRSGPVSDSLGKEHPASS

EKAKGGEEEEDTSDSDSDGLTLKELQNRLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGPVSQSETDDIENQLE

GKATQGNTEENPREAGKPKPECEVYDPNALYCICRQPHNNR - UNI29527 - RFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQV

QDETNGSATDEQDSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQP - UNI15101 - VVEAPGAPKCIGPGCSSVAQPDS

VYCSNDCILKHAAATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQ - UNI10154 - - UNI14814 - - UNI15101 - - UNI15315 -

 VGIKISSVHKRLASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKPTALSPTLLSKCTYHPKAGFPGPSHHLGGCLGLSRTR

VLGVLVLIVASSSLPARSRYQDASGPQVFLPSLWSLSGWFLKSCVGLMLEAISYFSFRPW

For any suggestions or comments, please send an email to unitrap@crg.es