Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038963 (Slco4a1)
Chromosomal location
Chr 2: 180191039 - 180209572 (+)
Description
solute carrier organic anion transporter family, member 4a1 Gene [Source:MGI (curated);Acc:Slco4a1-001]
RefSeq_dna
NM_148933 
RefSeq_peptide
NP_683735.1 
UniGene
Mm.133687 
MGI
MGI:1351866 
Uniprot/SWISSPROT
Q8K078 
Uniprot/SPTREMBL
A2ACT3 
Human Ortholog
ENSG00000101187 (SLCO4A1)
Omim not available
UniTrap UNI33141
Vector Insertion
Chr 2: 180191079 - 180195683
Public Clones IST10920F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038259
Sequence
AGAGCGCAGGGCGCAGCGCGGCAGCCGGGTTCGTGGGAAG - UNI33141 - ATAGACCCAGTGACAAGACAGTCTCTCGGCCACCTCTACTGCACCT

CGGCTGCTGTGCTGCCAAAGCCTTCCCCACGAGGCTGGACATGCCCCAGCACGCGATGGGGGACACACATTTCCTCTCCCTCCCGAAGCACCTCTTTACT

AGCACGTCCTCAGCCACGGACAGCGGGTGTGACACTCCGCCCAGCAGCAGAGCATCCCCAGCCTCCCTGCGCTCTGCCCACGGCACCCTGGGCTCCTCCA

GCCAACCCCTGTTTGAGCCCCAGGCTGAGAAGCGGAGTAGCCAGACAGCCCGTGAGGTGCAGTATGTGTCCTCGGGGCCACAGAACTCACTGTGCGGCTG

GCAAGCCTTCACGCCCAAGTGCTTGCAGGTCTTCAACACCCCCAAGGGCTTCCTCTTCTTCCTGTGTGCGGCCTCCTTCCTTCAGGGCATGACAGTGAAT

GGCTTCATCAATACTGTCATCACCTCCATCGAACGCCGCTTCGATCTGCACAGCTACCAGAGCGGGCTCATCGCCAGCTCCTATGACATCGCTGCCTGCC

TATGCCTTACCTTCGTCAGCTACTTTGGGGGCAATGGGCACAAACCGCGATGGCTGGGCTGGGGTGTGCTGGTCCTGGGAATCGGCTCCCTGGTATTTGC

ACTGCCCCATTTCACTGCCGGCCGCTATGAGGTAGAGATGGATGAGGGGCTGGGGACTGGGACGTGCCTGACTAATCAGAGTCATGTGGAGTGTAAAGAC

AGTGCCTCAGGCCTGTCCAACTACCGGCTGATCTTCATGCTGGGCCAGCTCCTGCACGGTGTGGGTGCCACGCCGCTCTACACACTGGGCGTCACGTACC

TGGATGAGAACGTCAAGTCAAGTTACTCACCCATCTATATCG CCATCTTCTACACGGCAGCCATCCTTGGACCTGCAGCAGGCTACCTGATTGGAGGAG

CCATGCTAAACGTTTACACAGAAGTGGGCCAACG GACGGAGCTGACCACTGACAGCCCACTGTGGGTTGGTGCCTGGTGGATCGGCTTCCTAGGAACCG

GGATTGCTGCATTCCTCATCGCCATCCCCATCCTTGGCTATCCCCGGCAGCTACCAG GCTCCCAGCGCTACGTTGTTATGAGAGCGGCTGAAACACAGC

AGCTGAAAGACCACAGCCGCGGAGCAGTGAGCAATCCAGCTTTTGGCAAGACTGTCAGAGACCTGCCCCT CTCCATCTGGCTCCTTCTAAGAAACCCCA

CGTTCATCCTGCTCTGCCTGGCAGGGGCCACTGAAGCCACACTCATTGCCGGCATGTCCACATTCGGTCCCAAGTTCTTCGAGGCCCAGTTCAGCTTGAG

TGCCTCCGAGGCTGCCACCCTGTTCG GATACCTGGTGGTGCCAGCAGGCGGTGGTGGTACACTCCTAGGTGGCTTCCTGGTAAACAAGTTCAAGCTCCG

TGGCTCTGGGATCATCAGGTTCTGTCTATTCTGCACCTTGACCAGCCTACTAGCCTTCTTTGTCTTCCTCATGCACTGCCCCAATGTGCACATGGCAGGT

GTGACCACCGGCTACGTTGGGAG CCTCCTGCCTAAAGGACAGCTGGACCTAAAGGCAGCTTGCAACGCCATCTACTGTTGCCAGCCGAAGCACTACAGC

CCCCTGTGTGGCTCAGATGGCACCATGTACTACTCTCCCTGCTACGCAGGCTGCCCTGCTGATGCCGAGACAGACCTGGGTGGCCAGAAG GTATACCGA

GGCTGTAGCTGTATCCTTGAGAAGGCTTCCTCTGGCTGGGGCAATGCTACCGCAGGGAAGTGCGCTTCCACCTGTCAGAGCAAGCCCTTCCTTCTGGTTC

TCGTGTTCGTTGTAATTATCTTTACATTCCTCAGCAGCATTCCAGCGCTAACTGCTACTCTACG GTGTGTCAGTGATCGGCAAAGATCCTTTGCCCTGG

GGATCCAGTGGATCGTCGTAAGAACACTAG GCAGTATTCCGGGGCCCATTGCCTTTGGCTGGGTGATTGACAAGGCCTGCCTGCTGTGGCAAGACCAGT

GTGGTCATCAGGGCTCCTGCTTCGTGTATGAGAATGAAGCCATGAGCCGGTACATGCTCATCGCAGGGCTCACTTTCAAG GTGTTGGGCTTCCTCTTCT

TCGTCGCCGCCTACTTTCTCTACAAGTCCCCTTCCGTGTCCTCAGATGGTCTAGAGGCCTCCCTGCCCAGCCAGTCCTCGGCCTCTGACAGTCCCACAGA

ACAGCTCCAGAGCAACGTGTGACAGCGCTGGCCTCTCCACATTTCCTGAGGACTCTTCCTGGAAACCCTGACCCACCCCCACAGGGCGGTAACACTGAGG

ACCTTGCAAAACCTCACACTGTGTTCTGGGGTCTCGCACTGCCCCACACTGTGACTGAGCAGCCTCTGAGGCGTTAAGGAGGAAGTCACGTGTGTCATAG

GGGTCACATATGAACCAGACACATTCCCCAAGCCCTGGAGTCTGAAAGGGGGTCACTACATTTCATAGACCATCACCTGATCCTGATTTCCTGTGTCTAC

TGAGAAGCCCCATGCAGGGCAGCAGTGCCCTGGGAATGATCCTGTGGAGCCAGCTATTGGGTAATTTGCTTGAATCTGCTTACTGCCTGTCCTGGAAGCC

CGGTGGCCTCCATGCGGGGCAGCAGCGACTTGAATCGTTATGTCCAGACGTATATTTTGCACTGAATGGTGTTTATGGAATCAGTTTTGTACTTGATCAT

GTGACTCATGTCCAAGCAAACTGCACTGAGGATTTGATCCCATCTGAGGTGCCACGCAGCTTGTGTGGACAGTGTGTTTCTATGTTTTTGGTTAGAGTGT

GTACATAATATATTTTAATATTTAAACC
Translation
 - UNI33141 - MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRSAHGTLGSSSQPLFEPQAEKRSSQTAREVQYVSSGPQNSLCG

WQAFTPKCLQVFNTPKGFLFFLCAASFLQGMTVNGFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFGGNGHKPRWLGWGVLVLGIGSLVF

ALPHFTAGRYEVEMDEGLGTGTCLTNQSHVECKDSASGLSNYRLIFMLGQLLHGVGATPLYTLGVTYLDENVKSSYSPIYIA AIFYTAAILGPAAGYLI

GGAMLNVYTEVGQR RTELTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPG GSQRYVVMRAAETQQLKDHSRGAVSNPAFGKTVRDLPL LSI

WLLLRNPTFILLCLAGATEATLIAGMSTFGPKFFEAQFSLSASEAATLFG GYLVVPAGGGGTLLGGFLVNKFKLRGSGIIRFCLFCTLTSLLAFFVFLM

HCPNVHMAGVTTGYVGS SLLPKGQLDLKAACNAIYCCQPKHYSPLCGSDGTMYYSPCYAGCPADAETDLGGQK VYRGCSCILEKASSGWGNATAGKCA

STCQSKPFLLVLVFVVIIFTFLSSIPALTATLR RCVSDRQRSFALGIQWIVVRTLG GSIPGPIAFGWVIDKACLLWQDQCGHQGSCFVYENEAMSRYM

LIAGLTFK VLGFLFFVAAYFLYKSPSVSSDGLEASLPSQSSASDSPTEQLQSNV
Transcript ENSMUST00000038225
Sequence
GGTGGAGCCTGCCTGGTAGGCTGAGACACAGAACAGGGAAGGTTGGCTATGTAAAAGAGTCATAACCCTGCTGTTCCCCACCTGCTCGGACTGAGAAAAC

TCCTCCAAATCTGGTGCCAACTTCTCCTGGTCTCAAATATTTGTTTTCCCTACTACACAGCTGCTAGAAGTGGACGTAGATGCAGGAGCCGGGACTGGCA

CACAGGCAGGCTCCACGGCA ATAGACCCAGTGACAAGACAGTCTCTCGGCCACCTCTACTGCACCTCGGCTGCTGTGCTGCCAAAGCCTTCCCCACGAG

GCTGGACATGCCCCAGCACGCGATGGGGGACACACATTTCCTCTCCCTCCCGAAGCACCTCTTTACTAGCACGTCCTCAGCCACGGACAGCGGGTGTGAC

ACTCCGCCCAGCAGCAGAGCATCCCCAGCCTCCCTGCGCTCTGCCCACGGCACCCTGGGCTCCTCCAGCCAACCCCTGTTTGAGCCCCAGGCTGAGAAGC

GGAGTAGCCAGACAGCCCGTGAGGTGCAGTATGTGTCCTCGGGGCCACAGAACTCACTGTGCGGCTGGCAAGCCTTCACGCCCAAGTGCTTGCAGGTCTT

CAACACCCCCAAGGGCTTCCTCTTCTTCCTGTGTGCGGCCTCCTTCCTTCAGGGCATGACAGTGAATGGCTTCATCAATACTGTCATCACCTCCATCGAA

CGCCGCTTCGATCTGCACAGCTACCAGAGCGGGCTCATCGCCAGCTCCTATGACATCGCTGCCTGCCTATGCCTTACCTTCGTCAGCTACTTTGGGGGCA

ATGGGCACAAACCGCGATGGCTGGGCTGGGGTGTGCTGGTCCTGGGAATCGGCTCCCTGGTATTTGCACTGCCCCATTTCACTGCCGGCCGCTATGAGGT

AGAGATGGATGAGGGGCTGGGGACTGGGACGTGCCTGACTAATCAGAGTCATGTGGAGTGTAAAGACAGTGCCTCAGGCCTGTCCAACTACCGGCTGATC

TTCATGCTGGGCCAGCTCCTGCACGGTGTGGGTGCCACGCCGCTCTACACACTGGGCGTCACGTACCTGGATGAGAACGTCAAGTCAAGTTACTCACCCA

TCTATATCG CCATCTTCTACACGGCAGCCATCCTTGGACCTGCAGCAGGCTACCTGATTGGAGGAGCCATGCTAAACGTTTACACAGAAGTGGGCCAAC

G GACGGAGCTGACCACTGACAGCCCACTGTGGGTTGGTGCCTGGTGGATCGGCTTCCTAGGAACCGGGATTGCTGCATTCCTCATCGCCATCCCCATCC

TTGGCTATCCCCGGCAGCTACCAG GCTCCCAGCGCTACGTTGTTATGAGAGCGGCTGAAACACAGCAGCTGAAAGACCACAGCCGCGGAGCAGTGAGCA

ATCCAGCTTTTGGCAAGACTGTCAGAGACCTGCCCCT CTCCATCTGGCTCCTTCTAAGAAACCCCACGTTCATCCTGCTCTGCCTGGCAGGGGCCACTG

AAGCCACACTCATTGCCGGCATGTCCACATTCGGTCCCAAGTTCTTCGAGGCCCAGTTCAGCTTGAGTGCCTCCGAGGCTGCCACCCTGTTCG GATACC

TGGTGGTGCCAGCAGGCGGTGGTGGTACACTCCTAGGTGGCTTCCTGGTAAACAAGTTCAAGCTCCGTGGCTCTGGGATCATCAGGTTCTGTCTATTCTG

CACCTTGACCAGCCTACTAGCCTTCTTTGTCTTCCTCATGCACTGCCCCAATGTGCACATGGCAGGTGTGACCACCGGCTACGTTGGGAG CCTCCTGCC

TAAAGGACAGCTGGACCTAAAGGCAGCTTGCAACGCCATCTACTGTTGCCAGCCGAAGCACTACAGCCCCCTGTGTGGCTCAGATGGCACCATGTACTAC

TCTCCCTGCTACGCAGGCTGCCCTGCTGATGCCGAGACAGACCTGGGTGGCCAGAAG GTATACCGAGGCTGTAGCTGTATCCTTGAGAAGGCTTCCTCT

GGCTGGGGCAATGCTACCGCAGGGAAGTGCGCTTCCACCTGTCAGAGCAAGCCCTTCCTTCTGGTTCTCGTGTTCGTTGTAATTATCTTTACATTCCTCA

GCAGCATTCCAGCGCTAACTGCTACTCTACG GTGTGTCAGTGATCGGCAAAGATCCTTTGCCCTGGGGATCCAGTGGATCGTCGTAAGAACACTAG GC

AGTATTCCGGGGCCCATTGCCTTTGGCTGGGTGATTGACAAGGCCTGCCTGCTGTGGCAAGACCAGTGTGGTCATCAGGGCTCCTGCTTCGTGTATGAGA

ATGAAGCCATGAGCCGGTACATGCTCATCGCAGGGCTCACTTTCAAG GTGTTGGGCTTCCTCTTCTTCGTCGCCGCCTACTTTCTCTACAAGTCCCCTT

CCGTGTCCTCAGATGGTCTAGAGGCCTCCCTGCCCAGCCAGTCCTCGGCCTCTGACAGTCCCACAGAACAGCTCCAGAGCAACGTGTGACAGCGCTGGCC

TCTCCACATTTCCTGAGGACTCTTCCTGGAAACCCTGACCCACCCCCACAGGGCGGTAACACTGAGGACCTTGCAAAACCTCACACTGTGTTCTGGGGTC

TCGCACTGCCCCACACTGTGACTGAGCAGCCTCTGAGGCGTTAAGGAGGAAGTCACGTGTGTCATAGGGGTCACATATGAACCAGACACATTCCCCAAGC

CCTGGAGTCTGAAAGGGGGTCACTACATTTCATAGACCATCACCTGATCCTGATTTCCTGTGTCTACTGAGAAGCCCCATGCAGGGCAGCAGTGCCCTGG

GAATGATCCTGTGGAGCCAGCTATTGGGTAATTTGCTTGAATCTGCTTACTGCCTGTCCTGGAAGCCCGGTGGCCTCCATGCGGGGCAGCAGCGACTTGA

ATCGTTATGTCCAGACGTATATTTTGCACTGAATGGTGTTTATGGAATCAGTTTTGTACTTGATCATGTGACTCATGTCCAAGCAAACTGCACTGAGGAT

TTGATCCCATCTGAGGTGCCACGCAGCTTGTGTGGACAGTGTGTTTCTATGTTTTTGGTTAGAGTGTGTACATAATATATTTTAATATTTAAACCAATGA

TCCTTGTGTGAT
Translation
 MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRSAHGTLGSSSQPLFEPQAEKRSSQTAREVQYVSSGPQNSLCGWQAFTPKCLQVFN

TPKGFLFFLCAASFLQGMTVNGFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFGGNGHKPRWLGWGVLVLGIGSLVFALPHFTAGRYEVE

MDEGLGTGTCLTNQSHVECKDSASGLSNYRLIFMLGQLLHGVGATPLYTLGVTYLDENVKSSYSPIYIA AIFYTAAILGPAAGYLIGGAMLNVYTEVGQ

R RTELTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPG GSQRYVVMRAAETQQLKDHSRGAVSNPAFGKTVRDLPL LSIWLLLRNPTFILLC

LAGATEATLIAGMSTFGPKFFEAQFSLSASEAATLFG GYLVVPAGGGGTLLGGFLVNKFKLRGSGIIRFCLFCTLTSLLAFFVFLMHCPNVHMAGVTTG

YVGS SLLPKGQLDLKAACNAIYCCQPKHYSPLCGSDGTMYYSPCYAGCPADAETDLGGQK VYRGCSCILEKASSGWGNATAGKCASTCQSKPFLLVLV

FVVIIFTFLSSIPALTATLR RCVSDRQRSFALGIQWIVVRTLG GSIPGPIAFGWVIDKACLLWQDQCGHQGSCFVYENEAMSRYMLIAGLTFK VLGF

LFFVAAYFLYKSPSVSSDGLEASLPSQSSASDSPTEQLQSNV

For any suggestions or comments, please send an email to unitrap@crg.es