Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038965 (Ube2l3)
Chromosomal location
Chr 16: 17152106 - 17202742 (-)
Description
ubiquitin-conjugating enzyme E2L 3 Gene [Source:MGI (curated);Acc:Ube2l3-001]
RefSeq_dna
NM_009456 
RefSeq_peptide
NP_033482.1 
UniGene
Mm.3074 Mm.387382 Mm.430149 Mm.449832 Mm.458059 Mm.458366 Mm.466419 
MGI
MGI:109240 
Uniprot/SWISSPROT
P68037 
Uniprot/SPTREMBL
Q3TIH9 Q3TW19 Q561N4 
Human Ortholog
ENSG00000185651 (UBE2L3)
Omim not available
UniTrap UNI2763
Vector Insertion
Chr 16: 17201527 - 17201564
Public Clones AK0046 (sanger) Q015E01 (ggtc) D032E09 (ggtc) P126E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36466
Vector Insertion
Chr 16: 17201527 - 17202743
Public Clones IST14980D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13985
Vector Insertion
Chr 16: 17176601 - 17201527
Public Clones (sanger) E123H04 (ggtc) D032E09 (ggtc) P126E05 (ggtc) E044E11 (ggtc)
CMHD-GT_181H4-3 (cmhd) CMHD-GT_504A8-3 (cmhd) CMHD-GT_151H6-3 (cmhd) CMHD-GT_298D5-3 (cmhd)
CMHD-GT_498A7-3 (cmhd) CMHD-GT_441B2-3 (cmhd) CMHD-GT_298C9-3 (cmhd) CMHD-GT_443G11-3 (cmhd)
IST14566F5 (tigm) IST14338D6 (tigm) IST13969H11 (tigm) IST14865G4 (tigm)
IST15003D7 (tigm) IST14517G7 (tigm) IST14184A9 (tigm) IST10905F4 (tigm)
IST12107C2 (tigm) IST10111B3 (tigm) IST13819G9 (tigm) IST12107D5 (tigm)
IST11578D12 (tigm) IST14311H9 (tigm) IST14619E1 (tigm)
Private Clones OST452017 (lexicon) OST451862 (lexicon) OST450979 (lexicon) OST450151 (lexicon)
OST447238 (lexicon) OST443421 (lexicon) OST443071 (lexicon) OST434568 (lexicon)
OST431508 (lexicon) OST428514 (lexicon) OST425385 (lexicon) OST425105 (lexicon)
OST420056 (lexicon) OST419065 (lexicon) OST401432 (lexicon) OST398234 (lexicon)
OST392092 (lexicon) OST389096 (lexicon) OST378773 (lexicon) OST378440 (lexicon)
OST373677 (lexicon) OST372839 (lexicon) OST372010 (lexicon) OST371650 (lexicon)
OST371236 (lexicon) OST356750 (lexicon) OST354112 (lexicon) OST353318 (lexicon)
OST352663 (lexicon) OST352619 (lexicon) OST352328 (lexicon) OST338459 (lexicon)
OST326722 (lexicon) OST316558 (lexicon) OST314262 (lexicon) OST313865 (lexicon)
OST312283 (lexicon) OST310076 (lexicon) OST301205 (lexicon) OST298455 (lexicon)
OST296086 (lexicon) OST295922 (lexicon) OST294901 (lexicon) OST292223 (lexicon)
OST282032 (lexicon) OST281640 (lexicon) OST268776 (lexicon) OST266156 (lexicon)
OST263149 (lexicon) OST257917 (lexicon) OST251416 (lexicon) OST250223 (lexicon)
OST249315 (lexicon) OST230910 (lexicon) OST220596 (lexicon) OST215994 (lexicon)
OST215970 (lexicon) OST209808 (lexicon) OST199950 (lexicon) OST195354 (lexicon)
OST188816 (lexicon) OST187013 (lexicon) OST179669 (lexicon) OST178603 (lexicon)
OST173193 (lexicon) OST172593 (lexicon) OST170901 (lexicon) OST170678 (lexicon)
OST168687 (lexicon) OST157010 (lexicon) OST149213 (lexicon) OST138128 (lexicon)
OST129487 (lexicon) OST123523 (lexicon) OST122601 (lexicon) OST122596 (lexicon)
OST122507 (lexicon) OST122504 (lexicon) OST122424 (lexicon) OST121579 (lexicon)
OST121558 (lexicon) OST113926 (lexicon) OST111651 (lexicon) OST109201 (lexicon)
OST107783 (lexicon) OST106445 (lexicon) OST91309 (lexicon) OST83970 (lexicon)
OST77076 (lexicon) OST74766 (lexicon) OST67623 (lexicon) OST60537 (lexicon)
OST50479 (lexicon) OST44302 (lexicon) OST34297 (lexicon) OST31986 (lexicon)
OST31445 (lexicon) OST28497 (lexicon) OST28277 (lexicon) OST28091 (lexicon)
OST28037 (lexicon) OST27840 (lexicon) OST25687 (lexicon) OST25490 (lexicon)
OST25356 (lexicon) OST25353 (lexicon) OST24905 (lexicon) OST24796 (lexicon)
OST24496 (lexicon) OST23971 (lexicon) OST23549 (lexicon) OST22618 (lexicon)
OST22582 (lexicon) OST19594 (lexicon) OST19551 (lexicon) OST19539 (lexicon)
OST19526 (lexicon) OST19119 (lexicon) OST18559 (lexicon) OST18540 (lexicon)
OST17913 (lexicon) OST17740 (lexicon) OST17674 (lexicon) OST17124 (lexicon)
OST16982 (lexicon) OST16804 (lexicon) OST16584 (lexicon) OST16184 (lexicon)
OST16056 (lexicon) OST16000 (lexicon) OST15561 (lexicon) OST14314 (lexicon)
OST13311 (lexicon) OST13197 (lexicon) OST12749 (lexicon) OST12388 (lexicon)
OST12368 (lexicon) OST9486 (lexicon) OST9210 (lexicon) OST9047 (lexicon)
OST8366 (lexicon) OST8113 (lexicon) OST7693 (lexicon) OST7252 (lexicon)
OST6479 (lexicon) OST6329 (lexicon) OST6155 (lexicon) OST5745 (lexicon)
OST5580 (lexicon) OST5436 (lexicon) OST5372 (lexicon) OST2497 (lexicon)
OST1859 (lexicon) OST1130 (lexicon) OST905 (lexicon) OST739 (lexicon)
OST727 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4483
Vector Insertion
Chr 16: 17160270 - 17176504
Public Clones XT0496 (sanger) CMHD-GT_424E11-3 (cmhd) IST14301H7 (tigm)
Private Clones OST452255 (lexicon) OST431143 (lexicon) OST428133 (lexicon) OST373681 (lexicon)
OST340420 (lexicon) OST339848 (lexicon) OST324178 (lexicon) OST310925 (lexicon)
OST296728 (lexicon) OST279536 (lexicon) OST277865 (lexicon) OST277116 (lexicon)
OST232481 (lexicon) OST231843 (lexicon) OST231474 (lexicon) OST227120 (lexicon)
OST217183 (lexicon) OST207923 (lexicon) OST176349 (lexicon) OST172026 (lexicon)
OST165059 (lexicon) OST149543 (lexicon) OST139744 (lexicon) OST138816 (lexicon)
OST136779 (lexicon) OST136016 (lexicon) OST135663 (lexicon) OST118731 (lexicon)
OST113645 (lexicon) OST96476 (lexicon) OST89606 (lexicon) OST59598 (lexicon)
OST52328 (lexicon) OST45166 (lexicon) OST38463 (lexicon) OST30776 (lexicon)
OST27565 (lexicon) OST26371 (lexicon) OST24340 (lexicon) OST23864 (lexicon)
OST23545 (lexicon) OST22356 (lexicon) OST22257 (lexicon) OST20922 (lexicon)
OST19920 (lexicon) OST18649 (lexicon) OST18362 (lexicon) OST17260 (lexicon)
OST17093 (lexicon) OST15832 (lexicon) OST14806 (lexicon) OST14761 (lexicon)
OST14434 (lexicon) OST14130 (lexicon) OST14119 (lexicon) OST13495 (lexicon)
OST12850 (lexicon) OST12328 (lexicon) OST9024 (lexicon) OST7076 (lexicon)
OST1754 (lexicon) OST946 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1709
Vector Insertion
Chr 16: 17154376 - 17160082
Public Clones CF0606 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12782
Vector Insertion
Chr 16: 17152105 - 17154376
Public Clones CMHD-GT_369C1-3 (cmhd)
Private Clones OST452165 (lexicon) OST390858 (lexicon) OST292511 (lexicon) OST283729 (lexicon)
OST278268 (lexicon) OST250934 (lexicon) OST250550 (lexicon) OST209885 (lexicon)
OST204891 (lexicon) OST165524 (lexicon) OST155780 (lexicon) OST128050 (lexicon)
OST112183 (lexicon) OST61929 (lexicon) OST34067 (lexicon) OST30754 (lexicon)
OST22316 (lexicon) OST22272 (lexicon) OST20315 (lexicon) OST13032 (lexicon)
OST12830 (lexicon) OST11081 (lexicon) OST7641 (lexicon) OST3452 (lexicon)
OST2240 (lexicon) OST2080 (lexicon) OST1179 (lexicon) OST947 (lexicon)
OST936 (lexicon) OST842 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115699
Sequence
AGTCTGGGGTCTTGGTGGCCTAGCCCACCATTCCCCCACTGGTGTCAAGTGATTTTCCCTTAGGGAGTCTATTAATTTTAGATAGAAAGGGCATCAAAAG

ACCAAAGCAAAAATCCTTTCTAATGGGCACATGGATGTTACTCATGGAGTACAG - UNI36466 - GTCACTCGAGTCTACACAGGATTCTATAGCCC

TGGGACCTGCACACAGTAGGCACATTTCTCTATTCCGCGCTCTTCCCGGTTAGCCCCTCCCCCGCTCCAGGAAGTGAGGGGGTTCTAGCCGCCTGGCCTA

CCGCGATGCATTTTGGGAAAGCAGCAGCACCAGATCCAAGATGGCGGCCAGCAGGAGGCTGATGAAG - UNI2763 - - UNI13985 - - UNI36

466 - GAGCTTGAAGAGATCCGCAAATGTGGAATGAAAAACTTCCGTAACATCCAGGTTGATGAAGCTAATTTATTGACTTGGCAAGGGCTTATTGTTC

CT - UNI4483 - GACAACCCTCCATATGATAAGGGAGCCTTCAGAATTGAAATCAACTTTCCAGCAGAGTATCCATTCAAACCACCCAAGATCACAT

TTAAAACAAAGATCTACCACCCTAACATCGATGAGAAGGGGCAGGTCTGTCTGCCAGTCATTAGTGCTGAAAACTGGAAGCCAGCCACCAAGACTGACCA

AG - UNI1709 - - UNI12782 - TAATCCAGTCCCTCATAGCACTGGTGAATGACCCCCAGCCTGAGCACCCACTCCGGGCTGACCTAGCTGAAG

AATACTCTAAGGACCGTAAAAAATTCTGTAAGAATGCTGAAGAGTTTACAAAGAAATATGGGGAAAAGCGACCTGTGGACTAAAATCTGCCATGAGTGAT

TCCAGCAAGTTTGAGCAGAGACCCCGAGCAGTGCATTCAGACACCCCGCAAAGCAGGACTCTGTGGAAATTGACACGTGCCACCAACTGGCGTCCGCTTG

TGGCAGTTACTAACTTTCTACAGTTTTCTTAATCAAAAGTGGTCTAGGTAACCTGTAAAGAAGGATTAAAAAATTCAGATGTTCTAGTTCTGCTTGCTTT

GTTTTAAAAATCACTGCTTTAGTCTACTTCAAAAGAATGGCATTTCTTTTCTTGCCCAAATTTACTCAAAGTTGCAGTTAGCCCAGAAGGTTTAAAGAAA

AAGGTTGTTGTGGTTTCTTCCCCCTTCCCCTCTCCCCACTTTTCGATTCCCACTTCCACAGACCAAGGCCCCAGCTCCCCACAGAGGTGGCCGCAGCACT

GACAACGTTTCCTGTGCCAACACTGCCTGTGGGTAATGAGTAGCTCACGCACCCCATTCCAGCTTAGTGATGTCTTTAAAAAATTATAAAACAGTATCAA

TGCCCTGTCCCAAAGGAACATCCATGCAAACAAAGAGAAGCCGTCTTTACGTAAAATTTTAGCAAAGGGTTTCCACAATAATAATAGACCCGACAGACAG

ACCCCCATGGTCCCTATCTGTAGTCAGACTGTGCTGGCTGGGTCTCTGCAGGGAACCTGTTATAGCAGGTTTGTGGTGACCTTGGAGGGAGGGTCTGCCA

GCAGAGAATACAGTGCGCTTGTGTGATGGACTTCTCACAGTCAGCAGCCCTTCCTGAAGCTGTGGTAGACCTGGTCATCACAGACCAAAAAAAAAAAAAA

AGGCCAGAATATTCTTTTGAAATTTCAAGCTTCTCTACCACCAAGCTCTGATAGGATGTGCCAAGGAGAGCTCCCACTCCTGAGCACAGCAGGCCACCAC

TGCCACCCTCCTCACGGCTTACCCTCAGCGGGGTCAGCCACGATGGCTCTGCCTCTCTCAGAGCAGCTGCTGGGACAGCCCAGGAACAGGGTGGCTTTTC

CCTCCCTCTGGACTCCAAACCTTTCCAGTCCGGCTCCACTTGAAGCTCACTCAATATCCTTTCAGTGTGTTTTATATTGTTTTGATTGCCTTTTTTTTGT

AGAAATAAAATTTGAGCTTAGAATTTATCATCAAATGAACTCTGTCAAGATTTGAATGTTAAATGTCTTTTCAAGGGAAGTGGGACGGACTGTCCTTGAC

GCAGTAGTGACACCCTGAGGAAGCTGATGGCCTGACTGCCCATGTTCACCAACTCACTTCTGCTACTAGGGGTCTAATCCTGTGGAGAAGATTGCCTCAA

GAAACCTTGCTTTCTGCTTTAACCTTAGTTCTATAACTTCCGGGCTACCTAGGCTTACAGACTTGGGAGACAGCTCTGGGTTTTGCCTATAAAAGAAGTA

AGACATGTCCTCTCAGGCAGTGTAACACTATTTAGTTTTCCAAGTGTTTGGCTCCTGTGATGCATAAATGAACTATGCTTTAGTTCAAGTTATGCATGGG

GCAGGTTTCTGGAGACTTCCATATGCCCAGGATGGTCAGAGCCCTGGGCCTGTGTTTCTACATCTGTCTCTTCATTGGCAGAAAAGTGACAATGGATTTT

ATTTCACTCATATTCAGATTTGTAATAAAATGCCAAACTCTGTCAGAATTGTCGAAGCAAACCACCATTTTGTTCATGTTGCTTTTCTGAATCTAGAGAT

AGTCCAGCTGTCTCATTGCTTAGCTCTACCTGCCTGTTACCCGTCACTGCTCTCTGCTCACTATGGGAGGGTACTCTTATGCCAGCAGCCCCTCTCAGGG

ACTCTCAGCCCCATTGTTGACAACCATGGCCTGCCCTGCCTTGGAGTCAGTGGTGTCCCTCTGGGCTTGCATGCCTTGTCCTGTCCAGCCCTGCCCTGAG

CAGGCTTTGAGCAAGGTGGCAGGGAGACCTGTGGAGCAGCCACCCACGCCTGACCCAAGCTGGCTCAGGAATCCACATCCCCCTGGTTCCTTGAAGTGCC

CGGGTCTCGTCCTGCTCTTCCCACAATGGCAGAGAATAGGCTTTCTAAGATGCTGTGACCCCATTCTGTCCTTAATAAAAATGTTCTCAGACATTAGA
Translation
 - UNI36466 - MAASRRLMK - UNI2763 - - UNI13985 - - UNI36466 - ELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP - UNI

4483 - DNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQV - UNI1709 - - UNI12782 - VIQS

LIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Transcript ENSMUST00000090192
Sequence
AGATCCAAGATGGCGGCCAGCAGGAGGCTGATGAAG - UNI2763 - - UNI13985 - - UNI36466 - GAGCTTGAAGAGATCCGCAAATGTG

GAATGAAAAACTTCCGTAACATCCAGGTTGATGAAGCTAATTTATTGACTTGGCAAGGGCTTATTGTTCCT - UNI4483 - GACAACCCTCCATATG

ATAAGGGAGCCTTCAGAATTGAAATCAACTTTCCAGCAGAGTATCCATTCAAACCACCCAAGATCACATTTAAAACAAAGATCTACCACCCTAACATCGA

TGAGAAGGGGCAGGTCTGTCTGCCAGTCATTAGTGCTGAAAACTGGAAGCCAGCCACCAAGACTGACCAAG - UNI1709 - - UNI12782 - TAA

TCCAGTCCCTCATAGCACTGGTGAATGACCCCCAGCCTGAGCACCCACTCCGGGCTGACCTAGCTGAAGAATACTCTAAGGACCGTAAAAAATTCTGTAA

GAATGCTGAAGAGTTTACAAAGAAATATGGGGAAAAGCGACCTGTGGACTAAAATCTGCCATGAGTGATTCCAGCAAGTTTGAGCAGAGACCCCGAGCAG

TGCATTCAGACACCCCGCAAAGCAGGACTCTGTGGAAATTGACACGTGCCACCAACTGGCGTCCGCTTGTGGCAGTTACTAACTTTCTACAGTTTTCTTA

ATCAAAAGTGGTCTAGGTAACCTGTAAAGAAGGATTAAAAAATTCAGATGTTCTAGTTCTGCTTGCTTTGTTTTAAAAATCACTGCTTTAGTCTACTTCA

AAAGAATGGCATTTCTTTTCTTGCCCAAATTTACTCAAAGTTGCAGTTAGCCCAGAAGGTTTAAAGAAAAAGGTTGTTGTGGTTTCTTCCCCCTTCCCCT

CTCCCCACTTTTCGATTCCCACTTCCACAGACCAAGGCCCCAGCTCCCCACAGAGGTGGCCGCAGCACTGACAACGTTTCCTGTGCCAACACTGCCTGTG

GGTAATGAGTAGCTCACGCACCCCATTCCAGCTTAGTGATGTCTTTAAAAAATTATAAAACAGTATCAATGCCCTGTCCCAAAGGAACATCCATGCAAAC

AAAGAGAAGCCGTCTTTACGTAAAATTTTAGCAAAGGGTTTCCACAATAATAATAGACCCGACAGACAGACCCCCATGGTCCCTATCTGTAGTCAGACTG

TGCTGGCTGGGTCTCTGCAGGGAACCTGTTATAGCAGGTTTGTGGTGACCTTGGAGGGAGGGTCTGCCAGCAGAGAATACAGTGCGCTTGTGTGATGGAC

TTCTCACAGTCAGCAGCCCTTCCTGAAGCTGTGGTAGACCTGGTCATCACAGACC
Translation
MAASRRLMK - UNI2763 - - UNI13985 - - UNI36466 - ELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP - UNI4483 - DNPPYDK

GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQV - UNI1709 - - UNI12782 - VIQSLIALVNDPQPEHPL

RADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Transcript ENSMUST00000115700
Sequence
GCATTTTGGGAAAGCAGCAGCACCAGATCCAAGATGGCGGCCAGCAGGAGGCTGATGAAG - UNI2763 - - UNI13985 - - UNI36466 - G

AGCTTGAAGAGATCCGCAAATGTGGAATGAAAAACTTCCGTAACATCCAGGTTGATGAAGCTAATTTATTGACTTGGCAAGGGCTTATTGTTCCT - UN

I4483 - GACAACCCTCCATATGATAAGGGAGCCTTCAGAATTGAAATCAACTTTCCAGCAGAGTATCCATTCAAACCACCCAAGATCACATTTAAAAC

AAAGATCTACCACCCTAACATCGATGAGAAGGGGCAGGTCTGTCTGCCAGTCATTAGTGCTGAAAACTGGAAGCCAGCCACCAAGACTGACCAAG - UN

I1709 - - UNI12782 - TAATCCAGTCCCTCATAGCACTG - UNI12782 - ACAGACCCCCATGGTCCCTATCTGTAGTCAGACTGTGCTGGC

TGGGTCTCTGCAGGGAACCTGTTATAGCAGGTTTGTGGTGACCTTGGAGGGAGGGTCTGCCAGCAGAGAATACAGTGCGCTTGTGTGATGGACTTCTCAC

AGTCAGCAGCCCTTCCTGAAGCTGTGGTAGACCTGGTCATCACAGACCAAAAAAAAAAAAAAA
Translation
MAASRRLMK - UNI2763 - - UNI13985 - - UNI36466 - ELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP - UNI4483 - DNPPYDK

GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQV - UNI1709 - - UNI12782 - VIQSLIAL - UNI1278

2 - TDPHGPYL

For any suggestions or comments, please send an email to unitrap@crg.es