Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039013 (Siglec5)
Chromosomal location
Chr 7: 50606765 - 50614901 (+)
Description
sialic acid binding Ig-like lectin E Gene [Source:MGI (curated);Acc:Siglec5-003]
RefSeq_dna
NM_145581 
RefSeq_peptide
NP_663556.1 
UniGene
Mm.290569 Mm.412877 
MGI
MGI:2681107 
Uniprot/SWISSPROT
Q920G3 
Uniprot/SPTREMBL
Q80ZE2 Q8BU57 
Human Ortholog
not available
Omim not available
UniTrap UNI20759
Vector Insertion
Chr 7: 50607380 - 50607537
Public Clones not available
Private Clones OST352929 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28730
Vector Insertion
Chr 7: 50611989 - 50613952
Public Clones not available
Private Clones OST22234 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121494
Sequence
ATGCGGTGGGCATGGCTGCTGCCCCTGCTGTGGGCAG GGTGCCTGGCTACGGACGGTTATTCGCTCTCAGTGACTGGTTCAGTGACAGTGCAGGAGGGC

CTGTGCGTCTTTGTAGCCTGCCAAGTCCAGTACCCCAATTCCAAAGGTCCTGTCTTTGGCTACTGGTTCCGGGAGGGGGCCAATATATTCAGCGGCTCTC

CAGTGGCTACAAATGACCCACAGCGATCAGTACTGAAGGAAGCTCAAGGTCGATTCTATCTCATGGGGAAGGAAAATAGTCATAATTGCTCCCTGGACAT

CAGAGATGCACAGAAAATCGACACAGGGACGTACTTCTTCAGATTGGATGGTTCTGTGAAATACAGTTTTCAGAAGTCAATGCTCTCTGTGCTTGTGATA

G - UNI20759 - CTCTGACTGAGGTCCCTAACATCCAAGTCACATCTACCCTGGTGTCTGGCAATTCTACCAAACTGCTCTGTTCTGTGCCCTGGGC

CTGTGAGCAGGGGACACCCCCCATCTTTTCCTGGATGTCATCTGCCCTCACTTCCCTGGGCCACAGGACCACCCTCTCCTCAGAGCTGAACCTCACACCC

AGGCCTCAGGACAATGGCACCAACCTCACCTGCCAGGTGAACTTACCTGGCACTGGTGTTACTGTGGAGAGGACTCAACAGCTCAGTGTCATCT ATGCT

CCACAGAAGATGACCATCAGGGTGTCCTGGGGAGATGACACAG GAACTAAAGTCCTGCAGAGTGGAGCATCTCTGCAGATCCAAGAGGGTGAGTCCCTG

AGCCTGGTCTGTATGGCTGACAGCAATCCCCCTGCCGTGCTGAGTTGGGAGCGCCCGACCCAAAAGCCCTTCCAGCTCTCTACCCCCGCGGAACTGCAAC

TGCCACGGGCGGAGTTGGAGGACCAGGGAAAATACATCTGCCAAGCTCAGAACAGTCAGGGTGCTCAGACAGCCTCTGTGAGCCTCAGCATAAGGA GCC

TTCTACAGCTGCTGGGACCCTCCTGCTCCTTCGAGGGTCAAGGTCTGCACTGCAGCTGCTCCTCCAGAGCCTGGCCTGCCCCCTCCCTGCGCTGGCGGCT

GGGGGAGGGGGTGCTGGAGGGGAACAGCAGCAATGGCTCCTTCACGGTTAAGTCCAGCTCCGCAGGACAGTGGGCCAACAGCTCCCTGATCCTCAGCATG

GAATTCAGCTCTAACCACAGACTCAGCTGTGAAGCTTGGAGTGACAATAGAGTTCAGAGAGCCACTATCTTGCTGGTGTCAGGCCCAAAGGTCTCACAGG

 CAGGCAAATCAGAAACCAGTAGAGGAACGGTCCTGGGGGCCATCTGGGGAGCTGGTCTTATGGCCTTGCTTGCTGTCTGCCTCTGCCTCATCTTTTTCA

C AGTGAAGGTCCTCAGGAAGAAATCAGCCCTGAAAGTAGCAGCTACGAAAGGCAACCATCTTGCCAAGAACCCTGCCTCCACCATAAATAGTGCAAGCA

TAACTTCATCCAACATTGCGTTGGGATACCCAATCCAG GTATTTGCCCAGGCCTGCCCATTGTTTCTGTTAGCAAAGCTCTTCCCAACGTAG
Translation
MRWAWLLPLLWAG GCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSL

DIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIA - UNI20759 - ALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGH

RTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIY YAPQKMTIRVSWGDDTG GTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWER

PTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRS SLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTV

KSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQA AGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFT TVKVLRKKSALKV

AATKGNHLAKNPASTINSASITSSNIALGYPIQ VFAQACPLFLLAKLFPT
Transcript ENSMUST00000085470
Sequence
TCTGTCTCTCTTCATTCCTGGACTAG GAACCTAGAGCCTTTCACTGTGTGATGCGGTGGGCATGGCTGCTGCCCCTGCTGTGGGCAG GGTGCCTGGCT

ACGGACGGTTATTCGCTCTCAGTGACTGGTTCAGTGACAGTGCAGGAGGGCCTGTGCGTCTTTGTAGCCTGCCAAGTCCAGTACCCCAATTCCAAAGGTC

CTGTCTTTGGCTACTGGTTCCGGGAGGGGGCCAATATATTCAGCGGCTCTCCAGTGGCTACAAATGACCCACAGCGATCAGTACTGAAGGAAGCTCAAGG

TCGATTCTATCTCATGGGGAAGGAAAATAGTCATAATTGCTCCCTGGACATCAGAGATGCACAGAAAATCGACACAGGGACGTACTTCTTCAGATTGGAT

GGTTCTGTGAAATACAGTTTTCAGAAGTCAATGCTCTCTGTGCTTGTGATAG - UNI20759 - CTCTGACTGAGGTCCCTAACATCCAAGTCACATC

TACCCTGGTGTCTGGCAATTCTACCAAACTGCTCTGTTCTGTGCCCTGGGCCTGTGAGCAGGGGACACCCCCCATCTTTTCCTGGATGTCATCTGCCCTC

ACTTCCCTGGGCCACAGGACCACCCTCTCCTCAGAGCTGAACCTCACACCCAGGCCTCAGGACAATGGCACCAACCTCACCTGCCAGGTGAACTTACCTG

GCACTGGTGTTACTGTGGAGAGGACTCAACAGCTCAGTGTCATCT ATGCTCCACAGAAGATGACCATCAGGGTGTCCTGGGGAGATGACACAG GAACT

AAAGTCCTGCAGAGTGGAGCATCTCTGCAGATCCAAGAGGGTGAGTCCCTGAGCCTGGTCTGTATGGCTGACAGCAATCCCCCTGCCGTGCTGAGTTGGG

AGCGCCCGACCCAAAAGCCCTTCCAGCTCTCTACCCCCGCGGAACTGCAACTGCCACGGGCGGAGTTGGAGGACCAGGGAAAATACATCTGCCAAGCTCA

GAACAGTCAGGGTGCTCAGACAGCCTCTGTGAGCCTCAGCATAAGGA GCCTTCTACAGCTGCTGGGACCCTCCTGCTCCTTCGAGGGTCAAGGTCTGCA

CTGCAGCTGCTCCTCCAGAGCCTGGCCTGCCCCCTCCCTGCGCTGGCGGCTGGGGGAGGGGGTGCTGGAGGGGAACAGCAGCAATGGCTCCTTCACGGTT

AAGTCCAGCTCCGCAGGACAGTGGGCCAACAGCTCCCTGATCCTCAGCATGGAATTCAGCTCTAACCACAGACTCAGCTGTGAAGCTTGGAGTGACAATA

GAGTTCAGAGAGCCACTATCTTGCTGGTGTCAGGCCCAAAGGTCTCACAGG CAGGCAAATCAGAAACCAGTAGAGGAACGGTCCTGGGGGCCATCTGGG

GAGCTGGTCTTATGGCCTTGCTTGCTGTCTGCCTCTGCCTCATCTTTTTCAC AGTGAAGGTCCTCAGGAAGAAATCAGCCCTGAAAGTAGCAGCTACGA

AAGGCAACCATCTTGCCAAGAACCCTGCCTCCACCATAAATAGTGCAAGCATAACTTCATCCAACATTGCGTTGGGATACCCAATCCAG GTATTTGCCC

AGGCCTGCCCATTGTTTCTGTTAGCAAAGCTCTTCCCAACGTAG
Translation
 MRWAWLLPLLWAG GCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCS

LDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIA - UNI20759 - ALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLG

HRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIY YAPQKMTIRVSWGDDTG GTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWE

RPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRS SLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFT

VKSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQA AGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFT TVKVLRKKSALK

VAATKGNHLAKNPASTINSASITSSNIALGYPIQ VFAQACPLFLLAKLFPT
Transcript ENSMUST00000122423
Sequence
ATTCCTGGACTAGGTTAGTAGGACGACTTCTCAGTCCTGTGACATTGAAGCCTGTGACCCTCACCCCAGGGATCCACTTCAAACTGATCAAGTTTTCTTT

CTCTGGCCACCCACAGGAACCTAGAGCCTTTCACTGTGTGATGCGGTGGGCATGGCTGCTGCCCCTGCTGTGGGCAG GGTGCCTGGCTACGGACGGTTA

TTCGCTCTCAGTGACTGGTTCAGTGACAGTGCAGGAGGGCCTGTGCGTCTTTGTAGCCTGCCAAGTCCAGTACCCCAATTCCAAAGGTCCTGTCTTTGGC

TACTGGTTCCGGGAGGGGGCCAATATATTCAGCGGCTCTCCAGTGGCTACAAATGACCCACAGCGATCAGTACTGAAGGAAGCTCAAGGTCGATTCTATC

TCATGGGGAAGGAAAATAGTCATAATTGCTCCCTGGACATCAGAGATGCACAGAAAATCGACACAGGGACGTACTTCTTCAGATTGGATGGTTCTGTGAA

ATACAGTTTTCAGAAGTCAATGCTCTCTGTGCTTGTGATAG - UNI20759 - CTCTGACTGAGGTCCCTAACATCCAAGTCACATCTACCCTGGTGT

CTGGCAATTCTACCAAACTGCTCTGTTCTGTGCCCTGGGCCTGTGAGCAGGGGACACCCCCCATCTTTTCCTGGATGTCATCTGCCCTCACTTCCCTGGG

CCACAGGACCACCCTCTCCTCAGAGCTGAACCTCACACCCAGGCCTCAGGACAATGGCACCAACCTCACCTGCCAGGTGAACTTACCTGGCACTGGTGTT

ACTGTGGAGAGGACTCAACAGCTCAGTGTCATCT ATGCTCCACAGAAGATGACCATCAGGGTGTCCTGGGGAGATGACACAG GAACTAAAGTCCTGCA

GAGTGGAGCATCTCTGCAGATCCAAGAGGGTGAGTCCCTGAGCCTGGTCTGTATGGCTGACAGCAATCCCCCTGCCGTGCTGAGTTGGGAGCGCCCGACC

CAAAAGCCCTTCCAGCTCTCTACCCCCGCGGAACTGCAACTGCCACGGGCGGAGTTGGAGGACCAGGGAAAATACATCTGCCAAGCTCAGAACAGTCAGG

GTGCTCAGACAGCCTCTGTGAGCCTCAGCATAAGGA GCCTTCTACAGCTGCTGGGACCCTCCTGCTCCTTCGAGGGTCAAGGTCTGCACTGCAGCTGCT

CCTCCAGAGCCTGGCCTGCCCCCTCCCTGCGCTGGCGGCTGGGGGAGGGGGTGCTGGAGGGGAACAGCAGCAATGGCTCCTTCACGGTTAAGTCCAGCTC

CGCAGGACAGTGGGCCAACAGCTCCCTGATCCTCAGCATGGAATTCAGCTCTAACCACAGACTCAGCTGTGAAGCTTGGAGTGACAATAGAGTTCAGAGA

GCCACTATCTTGCTGGTGTCAGGCCCAAAGGTCTCACAGG CAGGCAAATCAGAAACCAGTAGAGGAACGGTCCTGGGGGCCATCTGGGGAGCTGGTCTT

ATGGCCTTGCTTGCTGTCTGCCTCTGCCTCATCTTTTTCAC AGTGAAGGTCCTCAGGAAGAAATCAGCCCTGAAAGTAGCAGCTACGAAAGGCAACCAT

CTTGCCAAGAACCCTGCCTCCACCATAAATAGTGCAAGCATAACTTCATCCAACATTGCGTTGGGATACCCAATCCAG - UNI28730 - GGTCATCT

GAATGAACCAGGGTCACAGACCCAGAAAGAACAGCCACCCCTTGCCACAGTCCCAGACACCCAAAAGGATGAGCCTGAACTCCACTATGCCTCCCTCTCC

TTCCAAGGCCCGATGCCCCCGAAGCCTCAGAACACGGAGGCTATGAAATCTGTATACACAGAGATCAAGATCCACAAGTGCTGAAGTTCTTTGCTCCATG

TGTCCCAGTGCTGGCTGGAGTCCCAGAAAGGCATGGCCAAGGACAGCAAGTGTTAGAAGCATATTGTGATATCAGTGGCCCTCTAAACCAAAGGCTATGT

AGTGGAAGGAGGGAGTTTTGGAAGGAATGAAGGTCTCAGAGATTTCTAGGTTCAATTCCAGATTCAGTGTTATCCCCAGAGAAGCCACCTTTTCTCTTTG

TGCCCTCTCTTCCTCTTCTGTAATAATAATCACAAGGGTCTTAATCATGAGGAGTGTCAAGGAGAAAGTGTAGTGTTTATTGTTGATTATTTGGCTTTAT

ATTGCCTGAGCAGTGTGGAAGAACATTTTGACTTTAATGCATACTTGAATTTTACTTGTATATATTTAAGAACATATGTTAGTTCCTAAAGTTATTCTGT

TTTGAAGTGTGACTGTGTTGTAGCTACATATATCTCAAATTGAACTCATATTGGATGTTCTGCAAACTTTTAAAGATCACACAGATGCCAGCCCAGACTA

CTATACCCAGCAAAATTATCAATCACAGGGCATAAAATTAATATATAAAGATTTATCACAAATCAATAAAAGTGACAGATAATCAATACAAAATGGTATA

TGTGAGTGGCCAGCAAACATACAAGAAGGTAATCTCAGTCAGTGCTTGTCAATGAAATATAAATAAATACAATACAACTACCAAATTGTGCAGCAATTCT

GCTTAGAACTGTAGACCTAAATACACAAGATACAGTTGCTC
Translation
MRWAWLLPLLWAG GCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSL

DIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIA - UNI20759 - ALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGH

RTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIY YAPQKMTIRVSWGDDTG GTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWER

PTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRS SLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTV

KSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQA AGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFT TVKVLRKKSALKV

AATKGNHLAKNPASTINSASITSSNIALGYPIQ - UNI28730 - GHLNEPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKS

VYTEIKIHKC
Transcript ENSMUST00000012798
Sequence
TCTGTCTCTCTTCATTCCTGGACTAG GAACCTAGAGCCTTTCACTGTGTGATGCGGTGGGCATGGCTGCTGCCCCTGCTGTGGGCAG GGTGCCTGGCT

ACGGACGGTTATTCGCTCTCAGTGACTGGTTCAGTGACAGTGCAGGAGGGCCTGTGCGTCTTTGTAGCCTGCCAAGTCCAGTACCCCAATTCCAAAGGTC

CTGTCTTTGGCTACTGGTTCCGGGAGGGGGCCAATATATTCAGCGGCTCTCCAGTGGCTACAAATGACCCACAGCGATCAGTACTGAAGGAAGCTCAAGG

TCGATTCTATCTCATGGGGAAGGAAAATAGTCATAATTGCTCCCTGGACATCAGAGATGCACAGAAAATCGACACAGGGACGTACTTCTTCAGATTGGAT

GGTTCTGTGAAATACAGTTTTCAGAAGTCAATGCTCTCTGTGCTTGTGATAG - UNI20759 - CTCTGACTGAGGTCCCTAACATCCAAGTCACATC

TACCCTGGTGTCTGGCAATTCTACCAAACTGCTCTGTTCTGTGCCCTGGGCCTGTGAGCAGGGGACACCCCCCATCTTTTCCTGGATGTCATCTGCCCTC

ACTTCCCTGGGCCACAGGACCACCCTCTCCTCAGAGCTGAACCTCACACCCAGGCCTCAGGACAATGGCACCAACCTCACCTGCCAGGTGAACTTACCTG

GCACTGGTGTTACTGTGGAGAGGACTCAACAGCTCAGTGTCATCT ATGCTCCACAGAAGATGACCATCAGGGTGTCCTGGGGAGATGACACAG GAACT

AAAGTCCTGCAGAGTGGAGCATCTCTGCAGATCCAAGAGGGTGAGTCCCTGAGCCTGGTCTGTATGGCTGACAGCAATCCCCCTGCCGTGCTGAGTTGGG

AGCGCCCGACCCAAAAGCCCTTCCAGCTCTCTACCCCCGCGGAACTGCAACTGCCACGGGCGGAGTTGGAGGACCAGGGAAAATACATCTGCCAAGCTCA

GAACAGTCAGGGTGCTCAGACAGCCTCTGTGAGCCTCAGCATAAGGA GCCTTCTACAGCTGCTGGGACCCTCCTGCTCCTTCGAGGGTCAAGGTCTGCA

CTGCAGCTGCTCCTCCAGAGCCTGGCCTGCCCCCTCCCTGCGCTGGCGGCTGGGGGAGGGGGTGCTGGAGGGGAACAGCAGCAATGGCTCCTTCACGGTT

AAGTCCAGCTCCGCAGGACAGTGGGCCAACAGCTCCCTGATCCTCAGCATGGAATTCAGCTCTAACCACAGACTCAGCTGTGAAGCTTGGAGTGACAATA

GAGTTCAGAGAGCCACTATCTTGCTGGTGTCAGGCCCAAAGGTCTCACAGG CAGGCAAATCAGAAACCAGTAGAGGAACGGTCCTGGGGGCCATCTGGG

GAGCTGGTCTTATGGCCTTGCTTGCTGTCTGCCTCTGCCTCATCTTTTTCAC AGTGAAGGTCCTCAGGAAGAAATCAGCCCTGAAAGTAGCAGCTACGA

AAGGCAACCATCTTGCCAAGAACCCTGCCTCCACCATAAATAGTGCAAGCATAACTTCATCCAACATTGCGTTGGGATACCCAATCCAG - UNI28730

 - GGTCATCTGAATGAACCAGGGTCACAGACCCAGAAAGAACAGCCACCCCTTGCCACAGTCCCAGACACCCAAAAGGATGAGCCTGAACTCCACTATG

CCTCCCTCTCCTTCCAAGGCCCGATGCCCCCGAAGCCTCAGAACACGGAGGCTATGAAATCTGTATACACAGAGATCAAGATCCACAAGTGCTGAAGTTC

TTTGCTCCATGTGTCCCAGTGCTGGCTGGAGTCCCAGAAAGGCATGGCCAAGGACAGCAAGTGTTAGAAGCATATTGTGATATCAGTGGCCCTCTAAACC

AAAGGCTATGTAGTGGAAGGAGGGAGTTTTGGAAGGAATGAAGGTCTCAGAGATTTCTAGGTTCAATTCCAGATTCAGTGTTATCCCCAGAGAAGCCACC

TTTTCTCTTTGTGCCCTCTCTTCCTCTTCTGTAATAATAATCACAAGGGTCTTAATCATGAGGAGTGTCAAGGAGAAAGTGTAGTGTTTATTGTTGATTA

TTTGGCTTTATATTGCCTGAGCAGTGTGGAAGAACATTTTGACTTTAATGCATACTTGAATTTTACTTGTATATATTTAAGAACATATGTTAGTTCCTAA

AGTTATTCTGTTTTGAAGTGTGACTGTGTTGTAGCTACATATATCTCAAATTGAACTCATATTGGATGTTCTGCAAACTTTTAAAGATCACACAGATGCC

AGCCCAGACTACTATACCCAGCAAAATTATCAATCACAGGGCATAAAATTAATATATAAAGATTTATCACAAATCAATAAAAGTGACAGATAATCAATAC

AAAATGGTATATGTGAGTGGCCAGCAAACATACAAGAAGGTAATCTCAGTCAGTGCTTGTCAATGAAATATAAATAAATACAATACAAC
Translation
 MRWAWLLPLLWAG GCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCS

LDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIA - UNI20759 - ALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLG

HRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIY YAPQKMTIRVSWGDDTG GTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWE

RPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRS SLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFT

VKSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQA AGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFT TVKVLRKKSALK

VAATKGNHLAKNPASTINSASITSSNIALGYPIQ - UNI28730 - GHLNEPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMK

SVYTEIKIHKC

For any suggestions or comments, please send an email to unitrap@crg.es