Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039021 (Ttc16)
Chromosomal location
Chr 2: 32612546 - 32630868 (-)
Description
tetratricopeptide repeat domain 16 Gene [Source:MGI (curated);Acc:Ttc16-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35617
Vector Insertion
Chr 2: 32612545 - 32618526
Public Clones IST13505F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066478
Sequence
AGAAGCAAGGTGAGGGCTGAGAAGGGGAAAGCTGAGGCAGAGGTCGGGGCCGCAAGAAGGGCTTGAGGAAGAGCCAGTCAAGCCCTTCAGGGGAACTGGG

AGAG ACTCAGAGAACTCCATCTGCCTCTAGCTCTAGAACGGGGTTATTAAAGGTATGCACTACCGTGCCCAGCCCAAGTGGAGAGATTTTGAGGAGTGA

AACACAGAACTTGAGGACTGATGAGACATAGGTTCCCCGATTCTGGTGACTATGGGAAGGGTGATCACACAGAGGTGAGAAGCCCTGGGAAGAAGTCAGG

TGAAGTGCTTGCTCAATGTGACCTGACGAGTGTGAGAATCCCAGGGCGGGAGTCACAAGGAACCTTGTGCAGCAGGGTCTGAAAACGATGAGCAGCTAGA

GCACAAG GAGCCTCACAGTGCCCGTTCCCAGAAAACTCCAAAGCTAAAGGTTCCTGAAGCCCCAGAGAAGATCCTGCGACGCATCTTTGGGACCAGTCA

TGTGTTCTATGTTATGACAGATCCTACAAAACGAAGGATGATAGGATCAACAGTGCCTGCCAAAGTCAGAGAGTA CTATAACCAAGGCCATCAGTGCCT

CCTACAAGAGGACTGGGAGATGTCTGTGCTGTTCTTCTCCCGTGCCCTCCACCTGGACCCCAAACTG GTAGACTTCTATGTATTCCGTGCTGAGGCCTT

CATCCAACTCTGTGACTTCTCCTCTGCCCTCCAGAACCTCCGCAGGGCCTACTCCTATGACCCAGGGAATAACAAGTACCTGAACCGGCTGGCCTTTGTG

CTCTACCTACAG GGTCAGTGCCTGTATGAGCTGTGTGACTTCCAGGAAGCCCTCTGTGTCTTCCTGCAAGCCTCCGACCTCCAGCCCCAAAACGCTTCC

TTCAGTTACCGATG CATGGCCTGCCTGCTGGCCCTCAAGCGGTATCACGACTGCCTCGCCCTCATCACTAGGGAGGTGAAGCAGGGCAGGGCCAGCGCT

GATGTCTACATCCTCCGGGCTCGGCTCTACAACTTCTTCCAGAAG GCCAAGCTCTGCTATCAGGACCTTCGAAGCGCCTTGCTCCTAGATCCCTTGCAC

GCACAGGCCAAAGGGCTACTCCAGAAGATGGTGGACCAGGCCAAGCAGTCTCTCCAAGATGCCAGCACCCTGGCCGTGCAGGGCAAGGTGCACCGTGCAC

TGAAGTGCATCAACTGTGCCATTGAGAACAATCCCCTGGATCCCAACTTCTTCTTCTTCCG GGGCACCTTGCGTAGACGGCTCCAGCAATTTGACCATG

CTGTGGAAGACTTCCTGAAGGCAATGGACATGGTGACTGACACCCAGGACAACCTAGTGAAGCAGGCGCAGCGTCAGCTGCTGCTGACTTACAATGACTT

TGCTGTGCACTGCTACAACCATGGTGCCTATCAGGAGGGCGTGCTGCTGCTGAACAAGGCTATCAGAGACGAGCAGAATGAGAAGGGCTTGTACATCAAC

CGTGGGG ATTGCTTCTTCCAGCTGGGCAACCTGGCCTTCGCGGAGGCTGACTACAAGCAAGCGCTGGCCCTGAGCCCGCTGGATGAAGGAGCCAACTTG

CGCATGGGTGTGCTGCAGGAGAAGCTGGGCTTCTGCCAGCAGAAACACAG GCAGTTCCAGACAGCAGAGGAGCACTTCTCGGAGGCCATAAGGCACAGC

CCTCAGAAACCACAGTACTACCTGCACCGGGCCAAGTGCCGACAGTTCCTGCAGAACACTCTGGGGGCCCGCCTGGATGTCGCTACTGTACTGCTTCTCA

ATCCCGAGTATCCCAAG ATGGCTGCAGTGATGAACACCCTCTTTCCTAGCATGACTGTGGAGAATGTGCTTAAGTCCCAAGTGGCCGAACTGGCCAAGC

TCCAGCTAAGTCGGATGATAGAAAATGGGCCGAAGAACATCTACCCTCAGAGCACTGTGGT GCAGCGGTTATTGGAACGCAGGAAAGCCCAAGTCCTGG

TGAAGCTCTGGAAGCAGGAACGTCTTGGGACCCCTGAAGAGGAAGTGACTCTTTACCAGGCTCCGCAGCTGGCAGAGGAAAAAAAG GTGAAAACCGCTC

GCAGAAGGACATCCCTGACAGACAGCTATGCGGACCAGACCTCCTCAGGCTCCGTCTTTAGCA - UNI35617 - TTGTGAGCATCAGCACGTCGGGG

CCAGAGATGTCAACCAGTCAGGAGTATAAGAGCTCTTCCCACACGGCTATAGAATCCTCTGAGTCCACACTGCTAAAGCCTCAGCTCTCAGTACCCAGGA

AGAGCCAGGAACTGACCTGGAGCCCCAAGGTCGTCCAGGCAGTCACAGAGAACCTAATCCAGAACGCCACTGAGGTCACACCTGCCTATGGCCAAAGGGA

CTCCAAAAAGGCCACCCAAGTCCCAAAGCCCAAGAAGACAGAGGATCCCAAGGATCCTAGCCAGAGCACCAGCACGACAGAAGCCCCTGAGGGCCCAAGG

CCTAGCAAGTCCAGGTCTACCCTGAGCGTAAAGGAGAGAATCAGAAGAGCTAAGGCTGTTCGCGCCCAGGGCTGGAAACTCAAGGCCCAGCGCAGCAGCC

AGAAAGTAACAAAGACTCCCAGCCTGACCCACAGCACGACCCATAGTGACATTGGTGAGAGTGCCAATGATACCCCGGGCCAGACTCCATGGCCCAGCAA

GGCTGCTGATAGCTTAAGCTTCAGTGAGATCTCGTCAACAGATCTCAGCAGTAGTGAAAGCTTCTTGGAACTGACTAACCTTTTAACTCAGGAAGTCCAA

CAGATCCCAGGAGACAGAGAGAAGCTCACCTCTGACGATTAACTACTCCCTCAAAGGGCCAATGAAGCCCTTCCTGAGCAATGAACAGATTTCAGCCAAG

CTGCCTCCTCCCAGGACAGTAAGAAACTTTGGTCAATGTTCTAATACCAAGGCTAAGTTTATTTAATCTCTGTTCTCTTGTACAAAATTAAAAACTTTGA

AATTC
Translation
  MTDPTKRRMIGSTVPAKVREY YYNQGHQCLLQEDWEMSVLFFSRALHLDPKL VDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFV

LYLQ GQCLYELCDFQEALCVFLQASDLQPQNASFSYRC CMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQK AKLCYQDLRSALLLD

PLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFR RGTLRRRLQQFDHAVEDFLKAMDMVTDTQDNLVKQAQRQLLL

TYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGD DCFFQLGNLAFAEADYKQALALSPLDEGANLRMGVLQEKLGFCQQKHR RQFQTAEEH

FSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPK MAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIENGPKNIYPQSTVV VQR

LLERRKAQVLVKLWKQERLGTPEEEVTLYQAPQLAEEKK VKTARRRTSLTDSYADQTSSGSVFSI - UNI35617 - IVSISTSGPEMSTSQEYKSS

SHTAIESSESTLLKPQLSVPRKSQELTWSPKVVQAVTENLIQNATEVTPAYGQRDSKKATQVPKPKKTEDPKDPSQSTSTTEAPEGPRPSKSRSTLSVKE

RIRRAKAVRAQGWKLKAQRSSQKVTKTPSLTHSTTHSDIGESANDTPGQTPWPSKAADSLSFSEISSTDLSSSESFLELTNLLTQEVQQIPGDREKLTSD

D
Transcript ENSMUST00000091059
Sequence
ATGACAGACAGAAGCAAG ACTCAGAGAACTCCATCTGCCTCTAGCTCTAGAACGGGGTTATTAAAG GAGCCTCACAGTGCCCGTTCCCAGAAAACTCC

AAAGCTAAAGGTTCCTGAAGCCCCAGAGAAGATCCTGCGACGCATCTTTGGGACCAGTCATGTGTTCTATGTTATGACAGATCCTACAAAACGAAGGATG

ATAGGATCAACAGTGCCTGCCAAAGTCAGAGAGTA CTATAACCAAGGCCATCAGTGCCTCCTACAAGAGGACTGGGAGATGTCTGTGCTGTTCTTCTCC

CGTGCCCTCCACCTGGACCCCAAACTG GTAGACTTCTATGTATTCCGTGCTGAGGCCTTCATCCAACTCTGTGACTTCTCCTCTGCCCTCCAGAACCTC

CGCAGGGCCTACTCCTATGACCCAGGGAATAACAAGTACCTGAACCGGCTGGCCTTTGTGCTCTACCTACAG GGTCAGTGCCTGTATGAGCTGTGTGAC

TTCCAGGAAGCCCTCTGTGTCTTCCTGCAAGCCTCCGACCTCCAGCCCCAAAACGCTTCCTTCAGTTACCGATG CATGGCCTGCCTGCTGGCCCTCAAG

CGGTATCACGACTGCCTCGCCCTCATCACTAGGGAGGTGAAGCAGGGCAGGGCCAGCGCTGATGTCTACATCCTCCGGGCTCGGCTCTACAACTTCTTCC

AGAAG GCCAAGCTCTGCTATCAGGACCTTCGAAGCGCCTTGCTCCTAGATCCCTTGCACGCACAGGCCAAAGGGCTACTCCAGAAGATGGTGGACCAGG

CCAAGCAGTCTCTCCAAGATGCCAGCACCCTGGCCGTGCAGGGCAAGGTGCACCGTGCACTGAAGTGCATCAACTGTGCCATTGAGAACAATCCCCTGGA

TCCCAACTTCTTCTTCTTCCG GGGCACCTTGCGTAGACGGCTCCAGCAATTTGACCATGCTGTGGAAGACTTCCTGAAGGCAATGGACATGGTGACTGA

CACCCAGGACAACCTAGTGAAGCAGGCGCAGCGTCAGCTGCTGCTGACTTACAATGACTTTGCTGTGCACTGCTACAACCATGGTGCCTATCAGGAGGGC

GTGCTGCTGCTGAACAAGGCTATCAGAGACGAGCAGAATGAGAAGGGCTTGTACATCAACCGTGGGG ATTGCTTCTTCCAGCTGGGCAACCTGGCCTTC

GCGGAGGCTGACTACAAGCAAGCGCTGGCCCTGAGCCCGCTGGATGAAGGAGCCAACTTGCGCATGGGTGTGCTGCAGGAGAAGCTGGGCTTCTGCCAGC

AGAAACACAG GCAGTTCCAGACAGCAGAGGAGCACTTCTCGGAGGCCATAAGGCACAGCCCTCAGAAACCACAGTACTACCTGCACCGGGCCAAGTGCC

GACAGTTCCTGCAGAACACTCTGGGGGCCCGCCTGGATGTCGCTACTGTACTGCTTCTCAATCCCGAGTATCCCAAG ATGGCTGCAGTGATGAACACCC

TCTTTCCTAGCATGACTGTGGAGAATGTGCTTAAGTCCCAAGTGGCCGAACTGGCCAAGCTCCAGCTAAGTCGGATGATAGAAAATGGGCCGAAGAACAT

CTACCCTCAGAGCACTGTGGT GCAGCGGTTATTGGAACGCAGGAAAGCCCAAGTCCTGGTGAAGCTCTGGAAGCAGGAACGTCTTGGGACCCCTGAAGA

GGAAGTGACTCTTTACCAGGCTCCGCAGCTGGCAGAGGAAAAAAAG GTGAAAACCGCTCGCAGAAGGACATCCCTGACAGACAGCTATGCGGACCAGAC

CTCCTCAGGCTCCGTCTTTAGCA - UNI35617 - GTTTGCACCAGAGGCTCTCGGATCCCCACCTCCGCCGGCGGCCGGCGGGGCGGCAGATGTTTC

GAGCCCCTGCGAACTGCCGGCTGCCCGCCCGTCCGCACCGGCTCCCACCCCTCACCCGGCAAGTCGGGCCAGAAGTCGCATTCGCAGAACGAGCCGAAGG

TGCAGCGCAGAGAAGCCACGTCCCAGGCGGCGGCGGCAGCCAAGGCCAGCCCGAGCAGCCCGAGGATCGAGCCCCAGGGCCGGTAGCCGTGCCTCGCCAC

CGCCATCCGGTTGAGGCCCGATTTCGGTCAGAGGCCGCCCACCGCCAGAACCTGTGAACTACAGCTCCCGGTGTGCACCGCTCCGAGGCAGCCACGCCCA

TTGCCTACAACTCCCGGCTCCCCTTCCTTGGGGCTCTAAAACCCACAGGTTGTCTCGCAGCAGTACTGCAAATAGGCCTCCTGGGGGAGCCCGCGAACCA

CCCAGTCCCGCGTTGCCATGGTCACGGGTAACTAGCGGCCCGAAACCTTACCTCAGAAAGAATAAAAGATTAAGAGAGTG
Translation
MTDRSK TQRTPSASSSRTGLLK EPHSARSQKTPKLKVPEAPEKILRRIFGTSHVFYVMTDPTKRRMIGSTVPAKVREY YYNQGHQCLLQEDWEMSVL

FFSRALHLDPKL VDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQ GQCLYELCDFQEALCVFLQASDLQPQNASFSYRC CMA

CLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQK AKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCA

IENNPLDPNFFFFR RGTLRRRLQQFDHAVEDFLKAMDMVTDTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGD D

CFFQLGNLAFAEADYKQALALSPLDEGANLRMGVLQEKLGFCQQKHR RQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNP

EYPK MAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIENGPKNIYPQSTVV VQRLLERRKAQVLVKLWKQERLGTPEEEVTLYQAPQLAEEKK VKT

ARRRTSLTDSYADQTSSGSVFSS - UNI35617 - SLHQRLSDPHLRRRPAGRQMFRAPANCRLPARPHRLPPLTRQVGPEVAFAERAEGAAQRSHVP

GGGGSQGQPEQPEDRAPGPVAVPRHRHPVEARFRSEAAHRQNL

For any suggestions or comments, please send an email to unitrap@crg.es