Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039041 (Adrm1)
Chromosomal location
Chr 2: 179906332 - 179910989 (+)
Description
adhesion regulating molecule 1 Gene [Source:MGI (curated);Acc:Adrm1-001]
RefSeq_dna
NM_019822 
RefSeq_peptide
NP_062796.2 
UniGene
Mm.316654 
MGI
MGI:1929289 
Uniprot/SWISSPROT
Q9JKV1 
Uniprot/SPTREMBL
Q8VCI8 
Human Ortholog
ENSG00000130706 (ADRM1)
Omim not available
UniTrap UNI37953
Vector Insertion
Chr 2: 179906394 - 179906738
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11005
Vector Insertion
Chr 2: 179906953 - 179907560
Public Clones (sanger) W224C03 (ggtc)
Private Clones OST425352 (lexicon) OST128063 (lexicon) OST90352 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4236
Vector Insertion
Chr 2: 179907678 - 179908614
Public Clones (sanger) AK0384 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061437
Sequence
AGGCGCCGAGGAGGAAGAGCGAGCCCGGACGGTGCCCCTAGGCCGAGTGTGAGCACCGCCAG GATGACGACTTCAGGCGCTCTGTTCCCAAGCCTGGTG

CCCGGCTCTCGGGGGTCTTCTACCAAATATTTGGTGGAGTTCCGGGCAGGAAAAATGTCATTAAAAGGAACTACGGTCACCCCAGATAAACGGAAAGGTC

TCGTGTACATCCAGCAGACGGACGACTCCCTTATTCACTTCTGTTGGAAAGACAGGACCTCTGGGACCGTGGAGGAT - UNI11005 - GACTTGATT

ATCTTTCCTGATGACTGTGAGTTCAAGCGGGTACCTCAGTGCCCCAGTGGGAGGGTCTACGTGCTCAAGTTTAAGGCAGGGTCCAAGCGGCTCTTCTTCT

GGATGCAG - UNI4236 - GAGCCCAAGACTGACCAAGATGAGGAGCACTGCCGGAAAGTCAACGAGTGTCTGAACAACCCCCCCATGCCTGGGTCAC

TGGGAGCAAGTGGGAGTAGTGGCCATGAGCTTTCAGCACTGGGCG GTGAGGGTGGCCTGCAGAGCCTGTTGGGGAACATGAGTCACAGCCAGCTTATGC

AGCTCATCGGACCAGCCGGCCTGGGAGGACTGG GTGGACTTGGGGCCCTCACTGGGCCAGGCCTGGCCAGCTTGCTGGGGAGCAGTGGACCTCCAGCCA

GCAGCTCTTCATCCAG CTCCCGGAGCCAGTCGGCAGCCGTCACCCCATCCTCCTCCACCTCTTCCGCTCGCGCCACCCCAGCCCCTTCTGCCCCAGCAG

CTGCCTCGGCAACCAGCCCAAGCCCCGCACCCAGCTCAGGTAATGGAACCAGCACAGCAGCCAGCCCGACCCAGCCCATCCAGCTGAGCGACCTCCAGAG

CATTCTGGCCACTATGAACGTGCCGGCAGGGCCAGGAGGCAGCCAGCAAG TGGATCTGGCGAGTGTGCTGACCCCAGAGATCATGGCTCCCATCCTTGC

CAATGCAGACGTTCAGGAGCGCCTGCTGCCCTACCTGCCCTCTGGGGAGTCTCTGCCCCAGACTGCAGATGAGATCCAGAACACATTAACCTCGCCCCAG

TTCCAGCAG GCCCTGGGTATGTTCAGTGCGGCCTTGGCCTCAGGACAGCTTGGCCCTCTCATGTGCCAGTTCGGCCTTCCTGCAGAGGCTGTTGAGGCC

GCCAACAAAGGTG ATGTGGAAGCATTTGCCAAAGCCATGCAGAACAATGCCAAATCGGACCCAAAGGAGGGCGACACAAAAGACAAGAAAGACGAAGAA

GAAGATATGAGTCTAGACTAAATTATTCAGTGTCCGTCCCCAAGTTGGAATTGGTAGCTGTGTGATTCCGTAGTGGTGATTGTGATTTGCCCACCTCACT

AATAAAGTCCTTCCTTGTACCTGTC
Translation
 MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVED - UNI11005 - DLIIFPDDCEFKRV

PQCPSGRVYVLKFKAGSKRLFFWMQ - UNI4236 - EPKTDQDEEHCRKVNECLNNPPMPGSLGASGSSGHELSALGG GEGGLQSLLGNMSHSQLMQ

LIGPAGLGGLG GGLGALTGPGLASLLGSSGPPASSSSSS SSRSQSAAVTPSSSTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSD

LQSILATMNVPAGPGGSQQV VDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQ ALGMFSAALASGQLGPLMCQFGLPA

EAVEAANKGD DVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD
Transcript ENSMUST00000040492
Sequence
AGGCGCCGAGGAGGAAGAGCGAGCCCGGACGGTGCCCCTAGGCCGAGTGTGAGCACCGCCAG GATGACGACTTCAGGCGCTCTGTTCCCAAGCCTGGTG

CCCGGCTCTCGGGGGTCTTCTACCAAATATTTGGTGGAGTTCCGGGCAGGAAAAATGTCATTAAAAGGAACTACGGTCACCCCAGATAAACGGAAAGGTC

TCGTGTACATCCAGCAGACGGACGACTCCCTTATTCACTTCTGTTGGAAAGACAGGACCTCTGGGACCGTGGAGGAT - UNI11005 - GACTTGATT

ATCTTTCCTGATGACTGTGAGTTCAAGCGGGTACCTCAGTGCCCCAGTGGGAGGGTCTACGTGCTCAAGTTTAAGGCAGGGTCCAAGCGGCTCTTCTTCT

GGATGCAG - UNI4236 - GTGGACTTGGGGCCCTCACTGGGCCAGGCCTGGCCAGCTTGCTGGGGAGCAGTGGACCTCCAGCCAGCAGCTCTTCATC

CAG CTGCCTCGGCAACCAGCCCAAGCCCCGCACCCAGCTCAGGTAATGGAACCAGCACAGCAGCCAGCCCGACCCAGCCCATCCAGCTGAGCGACCTCC

AGAGCATTCTGGCCACTATGAACGTGCCGGCAGGGCCAGGAGGCAGCCAGCAAG TGGATCTGGCGAGTGTGCTGACCCCAGAGATCATGGCTCCCATCC

TTGCCAATGCAGACGTTCAGGAGCGCCTGCTGCCCTACCTGCCCTCTGGGGAGTCTCTGCCCCAGACTGCAGATGAGATCCAGAACACATTAACCTCGCC

CCAGTTCCAGCAG GCCCTGGGTATGTTCAGTGCGGCCTTGGCCTCAGGACAGCTTGGCCCTCTCATGTGCCAGTTCGGCCTTCCTGCAGAGGCTGTTGA

GGCCGCCAACAAAGGTG ATGTGGAAGCATTTGCCAAAGCCATGCAGAACAATGCCAAATCGGACCCAAAGGAGGGCGACACAAAAGACAAGAAAGACGA

AGAAGAAGATATGAGTCTAGACTAAATTATTCAGTGTCCGTCCCCAAGTTGGAATTGGTAGCTGTGTGATTCCGTAGTGGTGATTGTGATTTGCCCACCT

CACTAATAAAGTCCTTCCTTGTACCTGTC
Translation
 MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVED - UNI11005 - DLIIFPDDCEFKRV

PQCPSGRVYVLKFKAGSKRLFFWMQ - UNI4236 - VDLGPSLGQAWPACWGAVDLQPAALHPA AASATSPSPAPSSGNGTSTAASPTQPIQLSDLQ

SILATMNVPAGPGGSQQV VDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQ ALGMFSAALASGQLGPLMCQFGLPAEA

VEAANKGD DVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD

For any suggestions or comments, please send an email to unitrap@crg.es