Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039046 (Usp6nl)
Chromosomal location
Chr 2: 6243713 - 6367436 (+)
Description
USP6 N-terminal like Gene [Source:MGI (curated);Acc:Usp6nl-001]
RefSeq_dna
NM_181399 NM_001080548 
RefSeq_peptide
NP_852064.2 NP_001074017.1 
UniGene
Mm.40673 Mm.461242 
MGI
MGI:2138893 
Uniprot/SWISSPROT
Q80XC3 
Human Ortholog
ENSG00000148429 (USP6NL)
Omim not available
UniTrap UNI24558
Vector Insertion
Chr 2: 6244001 - 6257413
Public Clones not available
Private Clones OST215329 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11964
Vector Insertion
Chr 2: 6257413 - 6257506
Public Clones P004E03 (ggtc) P004F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29620
Vector Insertion
Chr 2: 6257506 - 6273781
Public Clones (sanger) E133H11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13730
Vector Insertion
Chr 2: 6273911 - 6312100
Public Clones E127B08 (ggtc) CMHD-GT_262F9-3 (cmhd) CMHD-GT_472H3-3 (cmhd) IST14891F7 (tigm)
Private Clones OST139202 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20674
Vector Insertion
Chr 2: 6312169 - 6315518
Public Clones not available
Private Clones OST355105 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27506
Vector Insertion
Chr 2: 6321366 - 6329974
Public Clones not available
Private Clones OST57878 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26425
Vector Insertion
Chr 2: 6330056 - 6335978
Public Clones not available
Private Clones OST118944 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9509
Vector Insertion
Chr 2: 6351625 - 6361406
Public Clones RRA055 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5702
Vector Insertion
Chr 2: 6361406 - 6364867
Public Clones CSI001 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042503
Sequence
GAAACCTGTTGCATCGCTAGTGGGAGCAGCTGGAGCCTCTGGCTTGCTAACTAGCAATGATTCAAGTCTTGCAGCTTGTAAAGGAGCTGGTGACACCGTC

CAGGCAGAAGGCAGCCACAGCGAAGGAAG - UNI13730 - ATTCCGACCAGGATGTAGCACTCAAACTTGCTCAAGAACGAGCTGAAATAGTTGCTA

AATATGACAGA - UNI20674 - GGGCGGGAAGGTGCAGAGATCGAGCCCTGGGAAGATGCTGATTATCTTGTTTACAAAGTCACCGATAGATTTGGC

TTTTTACA TGAGGAGGAGCTCCCATACCATAATGCAGCTGCGGACCGG - UNI27506 - CAAAAGCAACTGGAAATCGAAAGGACTTCCAAGTGGC

TGAAAATGCTGAAAAAATGGGAGAGATACAAGAACACCGAGAAG - UNI26425 - TTTCATCGACGAATTTACAAAGGAATTCCACTCCAGCTCCGA

GGTGAAGTCTGGGCTCTTCTTCTTGAGATCCCTAAAATGAAAGAAGAAACAAGAGACCTTTATAGT AAATTAAAACACAGAGCACGGGGTTGTTCACCT

GATATCAGACAAATAGACCTTGACGTGAACCGCACATTCAGGGACCATATTATGTTTAGAGACAGATACGGTGTTAA GCAACAGTCCTTATTCCATGTT

CTCGCTGCTTATTCTATCTATAATACG GAAGTCGGGTACTGCCAAGGGATGAGTCAGATCACGGCCTTGCTCCTCATGTACATGAACGAGGAAGACGCC

TTCTGGGCCCTGGTCAAGCTCTTCTCGGGCCCCAAGCACGCAATGCACG GTTTTTTTGTCCAAGGTTTTCCTAAACTCTTGAGATTTCAAGAACATCAT

GAGAAAATTCTGAACAAATTTTTGTCCAAACTTAAGCAGCACTTG GATTCTCAAGAAATCTACACAAGTTTTTACACAATGAAATGGTTTTTTCAGTGT

TTCCTTGATCGA ACTCCCTTCAGGCTGAACCTCAGGATATGGGACATCTATATCTTTGAAGGAGAGCGAGTCCTTACTGCTATGTCTTACACAATCTTG

AAACTACACAAAA AGCATCTGATGAAGTTGTCTATGGAAGAACTTGTAGAATTTCTTCAGGAGACTCTCGCCAAGGATTTTTTCTTCGAGGATGATTTT

GTAATAGAGCAACTTCAAGTTTCTATGGCAGAACTAAAGCGGGCAAAGTTAGATCTCCCAGAGCCTG - UNI5702 - - UNI9509 - GTAAGGAG

GATGAATATCCAAAGAAACCCTTGGGGCAGCTTCCACCTGAGTCTGCTTGTGTTAATCACTTGAGCAACGGACAAAGAAGTGTTGGCCGGCCCAGCCCCA

AAACAAGCAGCAGGAGAGAAGATGGATCGCCTCGCAAGAACCATGAGCACTCTCCTGTCCATCACAGTAGAAACGGCACACCAGAAAGAGCCGGCCAGTC

ACGGCGGAAGTCCGTGGATGAGGGGAGTAAAAATCTCAAGCATGAGGCAGAGTCTCAGAGAAAACCTTCACCGGGTATGCAGGACAGTTCCAGACACTAT

AACCATGCAGCTGCTAACCAAAATAGCAATGCAATTTCAAACGTCAGGAAGGAATTTATGCCCAAGTGGAGAAAACCATCAGATGCCTCAGCTATTGAAA

GAACTACTAAATATGCCGTCGAAGGCAAAAGTCACTCAGCTCTTCCCGCTCTTCCCGTCGCCATCCCAGGCTCTGCTGAGACCCGATTGCCAAACTCAAG

GCAGAAGATGAAGGCTTTGGATGGGGGTGAAGGGAAGCGGGGTTCTAACGCTTCCCAGTATGACAACGTGCCTGGGGGTGAGAGTGAGCATGGGGCATCT

GCGGAAGAGGGACCAGAGCGGACTCACCCTCACAGTCCAAGGAAGCACCCGGAGCCAAGTCCCAGTCCTCCAAAAGTACCCAACAAGTTTACGTTTAAAG

TGCAGCCTCCCAGCCATGTACGATACCCACCCCAGCTACCAGAGGAGGACCACAGAGCTGCATATCCACCCTCCTACAGCAACCCCCCTGTCTACCATGG

AAATTCTCCAAAACACGTCCCTACTGCTCACAGTGGTTTTGTGTCTACACAGATCAGCCCCAGGCCTCAAATTAACCCTTCCAGGAGACCTTACGGTTCC

TCTCTTTCAGTTGACACTTCTCCAGAGAAAGCCTACAGCCGCCCAACTCCTGTTGTTCTGCCCTCTAGTCGAATTGAAGTCCTTCCCATTGACATGGGTG

CCAGGGGCTACGGCAGTTCGGGGTCACCAAAGAATGGACAGTTCATCCTTCCTCCGGTGGACTATTTGCCAGAGAACAGAAAATGGTCAGAAGTTAGTTA

CACATACAGACCGGAGATGCATGGCCAATCATGGACTCGGGATGCTCACCGTAGCCACTTAAGCAATTTACCAAACTATGCAGCCTTTCAGCACATACCG

TTTCAGGCCCATGGCCTTCCAGAAGTGTCTGTAGACAGTCCAGTGAGGTATAAGATGTCTGCAGCTGTGGAAGATGCCAGTCCTCCTGGGTATCCATATG

CAGGGCCCTCACCTTCCGCACATCACTACAGAAATGGAGAGGGACTTTCTGTGCAGGAATCAGTGTTGCTGTGAGCGTGTGGCTGTATTCACTGACAAGA

GAATAGAAACAATATGCCCACATTGCTATGTTTATAATTGCCAGAGCAGTATTTTTTATATTGTAAACAGCGTGCGCAGCTCAGTGTGTGTCAGTGATAA

GAGTGTGGGAAGGCTTCATCCTCTGCAGAGGCTGCTGAAGAAGAGTGGGTCAGCTGCATCCTGGCTGAACCTTTAATAGGGGACCCTGGGGACCCAGCAG

TAGCACGAGGGCTGCACACACAGGGCGGCTCTCTGTGCTGGTCCCTTCGTAGCTCCCCAGACCCGCTCTGTTCCGTTGCTGTTAGAACAGTAGACTACTG

ACCGCTATAGAGCAGATACTCTGAGGGCCGACCCTCGCCTTTTCATAGACAGACGAGGCAACTGCATATAGGTTTTGTCTTTAAAACCACCTTTAATCTA

GATACATAGACTAACAGTGGATTTTTTTTAACCCTTTATCTTTCTGCCCACCCTGCCCAAACATATTTTAACCCAGGTTCTAAACTGAAACTGACTAGAG

ATGAATCCAGCGCCTGACAGAATGTCATTCTCCTTCAGTTGCTGCCATTTTATCTCCTCCTGAAAGCTAAAGGCTCACCACTTGATGGTGCCTAAAGTGG

GTCGGTTACCCGAGTGAGCGGCTGCACAGTGCTCACTGAGTCCCCTCATCTCCAGCAGTCTTGGTGCTGCTGTGCCCCGGGCTCTGGTCTGGCCGGGTGT

GAGGGAAGTCAGACCTTGCAGGGCCCCAGGCCGCAGAAGATTGCATTTCACAGTCGTGGGGAAGCAGCTCTAACCATAAGGAAGGCTGCTTCTCACCCTG

CTTCCCCTTCTCACAGGCTTTCTCTGGCACTCGGTCTTCACAGAGCACAGTGGGTGGATACTGCTAACACTTACTGGGCCCCGGTCGAAATTGTGAAAAA

TACCCTAATGATTAATAAGGAATTTTAATCTAGAATTTTGATCTTTGTAAAAAAAGGGGAAAAAGGGTAGTTTGTTTCATACTTTTGGAATTTTTTTTCA

GTGAAAAATAACTGAAGTTCATGGTTTTTAAAAAAGGTGATGATTCCTTTTATGCTATCACACACTACTGTCACCGAGACACTGACAAAGTGCTGGGTTC

TCCAAGAGCGATGGCGGCGTCTGTGTAGGTGCTCGCCCACCGTTACCCTCTTCTTGTATCTGAATATCAGAAACTAGAAAGTCCAACAGTGACACTCCCC

CTGCTCCAAGGTGGGGACTTAAGTTTGTGAGGTACAAGAATATGTTTTCATGAAAGTAACATTGTTTATCTAGCAAACGTGACAATATTTTTATGTATAT

AATGATTCTAATCTAAGTTAATTAATGTGGTAATGATGTTATTAAGTGTGGAAGCAAATGCAGTATATTAAAGGTGAACACCACACTGAAACTCCCAACT

CCTGACAGAATAACCAGGCTCTTGATTTAGATCATGTGGAAGGTGAGATATAAATGTATATAGACATGTAGCTGAGGATATTAATTTCAGTCTTAAAGTG

TGACTTGTAAGGAGCCAAGCTGTACAGTTTAGTTCATGATGGCAGCTCTCTGCCTCTTCAGAAAGTATATATCATAGTGGTAAATAATGTAGATTATATA

TATACATATATATATATATATATGCTATATATGGACACACTATTTTCTTATGTCATCTATGGCATTTTTTTATCTGTATACTTTTTGATGTGGTTGATTG

TTTTTAACATGCTAAAAGTAATCCGTGTATTTTGTTCTGTGTCTTCTGTGTGCAGCTTCCCCGTGGCAAGTGTGTCCTGGCCTTGCAGGGCCTGGCAGAT

GCACCACGGGCTCACCAGCAGCGTTTACCCACGCTGTGCTTCTCTGCTTGCATTTCCAGGGAGACCGTGTTTTGAACCGCATCACCTTTCCTTGGCTTAA

GCATTCGTTACTAATGGCAGGAAAGTCTTCCCTTCTATAAGATATATATCTCTGTTAGCTTCAAGTAGGAAATTTTAATTTAAAATTATTTTGCCACTAT

AAAATTTTATTTTAAATTTATTTTTAAATAAAAGAAATGATAAGAGAAATAA
Translation
MIQVLQLVKELVTPSRQKAATAKED - UNI13730 - DSDQDVALKLAQERAEIVAKYDR - UNI20674 - GREGAEIEPWEDADYLVYKVTDRF

GFLH HEEELPYHNAAADR - UNI27506 - QKQLEIERTSKWLKMLKKWERYKNTEK - UNI26425 - FHRRIYKGIPLQLRGEVWALLLEIPK

MKEETRDLYS KLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYGVK KQQSLFHVLAAYSIYNT EVGYCQGMSQITALLLMYMNEEDAFWALVKLFS

GPKHAMHG GFFVQGFPKLLRFQEHHEKILNKFLSKLKQHL DSQEIYTSFYTMKWFFQCFLDR TPFRLNLRIWDIYIFEGERVLTAMSYTILKLHKK 

KHLMKLSMEELVEFLQETLAKDFFFEDDFVIEQLQVSMAELKRAKLDLPEPG - UNI5702 - - UNI9509 - GKEDEYPKKPLGQLPPESACVNH

LSNGQRSVGRPSPKTSSRREDGSPRKNHEHSPVHHSRNGTPERAGQSRRKSVDEGSKNLKHEAESQRKPSPGMQDSSRHYNHAAANQNSNAISNVRKEFM

PKWRKPSDASAIERTTKYAVEGKSHSALPALPVAIPGSAETRLPNSRQKMKALDGGEGKRGSNASQYDNVPGGESEHGASAEEGPERTHPHSPRKHPEPS

PSPPKVPNKFTFKVQPPSHVRYPPQLPEEDHRAAYPPSYSNPPVYHGNSPKHVPTAHSGFVSTQISPRPQINPSRRPYGSSLSVDTSPEKAYSRPTPVVL

PSSRIEVLPIDMGARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYTYRPEMHGQSWTRDAHRSHLSNLPNYAAFQHIPFQAHGLPEVSVDSPVRYKMS

AAVEDASPPGYPYAGPSPSAHHYRNGEGLSVQESVLL
Transcript ENSMUST00000114937
Sequence
CGGCCGCAACGGCGACTGTTGGCGGCCGGTGAGGCGGGCGGGGCCGGCGGCGCGGAGGCGGGGTCCCGGGAGAGCCGCCCTGGGGAAGGCGGGGGCCGTT

TCCATAGCGGCGGCGGCTGGAGGTGTCGCGCCGGGGAACTTCCTGGTTCCCGGGCTCGGCTTTGCCGGGAGCCTCCTGGAAGGGAAACAATGGGGCGGAG

GGCACTGCGGTAGCCGCCGCCGCCGCCGCGCCGGACCTCTCGGCCTCCCGCGACTGGCCGCCGCCGCCGCCGCCGGGACCGCTTGGAG - UNI11964 

- - UNI24558 - AACAGGATATGTATTCCTCTGAGAAACCCTGGACAGCAGATCTTGGTTTAATACTGGATTGGAACAACACCCACAGAGGTTTGCA

GTCATGA - UNI11964 - - UNI13730 - - UNI29620 - ATTCCGACCAGGATGTAGCACTCAAACTTGCTCAAGAACGAGCTGAAATAGTT

GCTAAATATGACAGA - UNI20674 - GGGCGGGAAGGTGCAGAGATCGAGCCCTGGGAAGATGCTGATTATCTTGTTTACAAAGTCACCGATAGATT

TGGCTTTTTACA TGAGGAGGAGCTCCCATACCATAATGCAGCTGCGGACCGG - UNI27506 - CAAAAGCAACTGGAAATCGAAAGGACTTCCAAG

TGGCTGAAAATGCTGAAAAAATGGGAGAGATACAAGAACACCGAGAAG - UNI26425 - TTTCATCGACGAATTTACAAAGGAATTCCACTCCAGCT

CCGAGGTGAAGTCTGGGCTCTTCTTCTTGAGATCCCTAAAATGAAAGAAGAAACAAGAGACCTTTATAGT AAATTAAAACACAGAGCACGGGGTTGTTC

ACCTGATATCAGACAAATAGACCTTGACGTGAACCGCACATTCAGGGACCATATTATGTTTAGAGACAGATACGGTGTTAA GCAACAGTCCTTATTCCA

TGTTCTCGCTGCTTATTCTATCTATAATACG GAAGTCGGGTACTGCCAAGGGATGAGTCAGATCACGGCCTTGCTCCTCATGTACATGAACGAGGAAGA

CGCCTTCTGGGCCCTGGTCAAGCTCTTCTCGGGCCCCAAGCACGCAATGCACG GTTTTTTTGTCCAAGGTTTTCCTAAACTCTTGAGATTTCAAGAACA

TCATGAGAAAATTCTGAACAAATTTTTGTCCAAACTTAAGCAGCACTTG GATTCTCAAGAAATCTACACAAGTTTTTACACAATGAAATGGTTTTTTCA

GTGTTTCCTTGATCGA ACTCCCTTCAGGCTGAACCTCAGGATATGGGACATCTATATCTTTGAAGGAGAGCGAGTCCTTACTGCTATGTCTTACACAAT

CTTGAAACTACACAAAA AGCATCTGATGAAGTTGTCTATGGAAGAACTTGTAGAATTTCTTCAGGAGACTCTCGCCAAGGATTTTTTCTTCGAGGATGA

TTTTGTAATAGAGCAACTTCAAGTTTCTATGGCAGAACTAAAGCGGGCAAAGTTAGATCTCCCAGAGCCTG - UNI5702 - - UNI9509 - GTAA

GGAGGATGAATATCCAAAGAAACCCTTGGGGCAGCTTCCACCTGAGTCTGCTTGTGTTAATCACTTGAGCAACGGACAAAGAAGTGTTGGCCGGCCCAGC

CCCAAAACAAGCAGCAGGAGAGAAGATGGATCGCCTCGCAAGAACCATGAGCACTCTCCTGTCCATCACAGTAGAAACGGCACACCAGAAAGAGCCGGCC

AGTCACGGCGGAAGTCCGTGGATGAGGGGAGTAAAAATCTCAAGCATGAGGCAGAGTCTCAGAGAAAACCTTCACCGGGTATGCAGGACAGTTCCAGACA

CTATAACCATGCAGCTGCTAACCAAAATAGCAATGCAATTTCAAACGTCAGGAAGGAATTTATGCCCAAGTGGAGAAAACCATCAGATGCCTCAGCTATT

GAAAGAACTACTAAATATGCCGTCGAAGGCAAAAGTCACTCAGCTCTTCCCGCTCTTCCCGTCGCCATCCCAGGCTCTGCTGAGACCCGATTGCCAAACT

CAAGGCAGAAGATGAAGGCTTTGGATGGGGGTGAAGGGAAGCGGGGTTCTAACGCTTCCCAGTATGACAACGTGCCTGGGGGTGAGAGTGAGCATGGGGC

ATCTGCGGAAGAGGGACCAGAGCGGACTCACCCTCACAGTCCAAGGAAGCACCCGGAGCCAAGTCCCAGTCCTCCAAAAGTACCCAACAAGTTTACGTTT

AAAGTGCAGCCTCCCAGCCATGTACGATACCCACCCCAGCTACCAGAGGAGGACCACAGAGCTGCATATCCACCCTCCTACAGCAACCCCCCTGTCTACC

ATGGAAATTCTCCAAAACACGTCCCTACTGCTCACAGTGGTTTTGTGTCTACACAGATCAGCCCCAGGCCTCAAATTAACCCTTCCAGGAGACCTTACGG

TTCCTCTCTTTCAGTTGACACTTCTCCAGAGAAAGCCTACAGCCGCCCAACTCCTGTTGTTCTGCCCTCTAGTCGAATTGAAGTCCTTCCCATTGACATG

GGTGCCAGGGGCTACGGCAGTTCGGGGTCACCAAAGAATGGACAGTTCATCCTTCCTCCGGTGGACTATTTGCCAGAGAACAGAAAATGGTCAGAAGTTA

GTTACACATACAGACCGGAGATGCATGGCCAATCATGGACTCGGGATGCTCACCGTAGCCACTTAAGCAATTTACCAAACTATGCAGCCTTTCAGCACAT

ACCGTTTCAGGCCCATGGCCTTCCAGAAGTGTCTGTAGACAGTCCAGTGAGGTATAAGATGTCTGCAGCTGTGGAAGATGCCAGTCCTCCTGGGTATCCA

TATGCAGGGCCCTCACCTTCCGCACATCACTACAGAAATGGAGAGGGACTTTCTGTGCAGGAATCAGTGTTGCTGTGAGCGTGTGGCTGTATTCACTGAC

AAGAGAATAGAAACAATATGCCCACATTGCTATGTTTATAATTGCCAGAGCAGTATTTTTTATATTGTAAACAGCGTGCGCAGCTCAGTGTGTGTCAGTG

ATAAGAGTGTGGGAAGGCTTCATCCTCTGCAGAGGCTGCTGAAGAAGAGTGGGTCAGCTGCATCCTGGCTGAACCTTTAATAGGGGACCCTGGGGACCCA

GCAGTAGCACGAGGGCTGCACACACAGGGCGGCTCTCTGTGCTGGTCCCTTCGTAGCTCCCCAGACCCGCTCTGTTCCGTTGCTGTTAGAACAGTAGACT

ACTGACCGCTATAGAGCAGATACTCTGAGGGCCGACCCTCGCCTTTTCATAGACAGACGAGGCAACTGCATATAGGTTTTGTCTTTAAAACCACCTTTAA

TCTAGATACATAGACTAACAGTGGATTTTTTTTAACCCTTTATCTTTCTGCCCACCCTGCCCAAACATATTTTAACCCAGGTTCTAAACTGAAACTGACT

AGAGATGAATCCAGCGCCTGACAGAATGTCATTCTCCTTCAGTTGCTGCCATTTTATCTCCTCCTGAAAGCTAAAGGCTCACCACTTGATGGTGCCTAAA

GTGGGTCGGTTACCCGAGTGAGCGGCTGCACAGTGCTCACTGAGTCCCCTCATCTCCAGCAGTCTTGGTGCTGCTGTGCCCCGGGCTCTGGTCTGGCCGG

GTGTGAGGGAAGTCAGACCTTGCAGGGCCCCAGGCCGCAGAAGATTGCATTTCACAGTCGTGGGGAAGCAGCTCTAACCATAAGGAAGGCTGCTTCTCAC

CCTGCTTCCCCTTCTCACAGGCTTTCTCTGGCACTCGGTCTTCACAGAGCACAGTGGGTGGATACTGCTAACACTTACTGGGCCCCGGTCGAAATTGTGA

AAAATACCCTAATGATTAATAAGGAATTTTAATCTAGAATTTTGATCTTTGTAAAAAAAGGGGAAAAAGGGTAGTTTGTTTCATACTTTTGGAATTTTTT

TTCAGTGAAAAATAACTGAAGTTCATGGTTTTTAAAAAAGGTGATGATTCCTTTTATGCTATCACACACTACTGTCACCGAGACACTGACAAAGTGCTGG

GTTCTCCAAGAGCGATGGCGGCGTCTGTGTAGGTGCTCGCCCACCGTTACCCTCTTCTTGTATCTGAATATCAGAAACTAGAAAGTCCAACAGTGACACT

CCCCCTGCTCCAAGGTGGGGACTTAAGTTTGTGAGGTACAAGAATATGTTTTCATGAAAGTAACATTGTTTATCTAGCAAACGTGACAATATTTTTATGT

ATATAATGATTCTAATCTAAGTTAATTAATGTGGTAATGATGTTATTAAGTGTGGAAGCAAATGCAGTATATTAAAGGTGAACACCACACTGAAACTCCC

AACTCCTGACAGAATAACCAGGCTCTTGATTTAGATCATGTGGAAGGTGAGATATAAATGTATATAGACATGTAGCTGAGGATATTAATTTCAGTCTTAA

AGTGTGACTTGTAAGGAGCCAAGCTGTACAGTTTAGTTCATGATGGCAGCTCTCTGCCTCTTCAGAAAGTATATATCATAGTGGTAAATAATGTAGATTA

TATATATACATATATATATATATATATGCTATATATGGACACACTATTTTCTTATGTCATCTATGGCATTTTTTTATCTGTATACTTTTTGATGTGGTTG

ATTGTTTTTAACATGCTAAAAGTAATCCGTGTATTTTGTTCTGTGTCTTCTGTGTGCAGCTTCCCCGTGGCAAGTGTGTCCTGGCCTTGCAGGGCCTGGC

AGATGCACCACGGGCTCACCAGCAGCGTTTACCCACGCTGTGCTTCTCTGCTTGCATTTCCAGGGAGACCGTGTTTTGAACCGCATCACCTTTCCTTGGC

TTAAGCATTCGTTACTAATGGCAGGAAAGTCTTCCCTTCTATAAGATATATATCTCTGTTAGCTTCAAGTAGGAAATTTTAATTTAAAATTATTTTGCCA

CTATAAAATTTTATTTTAAATTTATTTTTAAATAAAAGAAATGATAAGAGAAATAATATTGACAAAGTGATTCAAAATCTATTTATAGAAAGGCTTGCTG

GGGACATTCCAGGCAGATGAGCAGCCATGCCCCATAACGGCGTGCCCACAGTGGCCGGGCCATGGCTTAGGCTTCCCTCATGGTCACTTTGCCCATTACG

TCAGAAGTAAGTGTCTGGGTGTGGTAGTATAAGTTTCTTAAGGAATTGTCCTGCTGACCTGTATCTAACTAATGAACTTAAGGGTCTGGGTTTTTTTTTC

TTTTGTTTGTTTGTTCATTTTGTTCATTTGTTTGTTTATTTTGTTTTTAATTATCAAGTCTCACCCCAGACCACTTAAATCCTATCTTTGGTAAAACGCA

GGTATCAGAGAAGCATATTTCCCTTGTGTCTCTTAATACTGTCATCTTGAAACTCTCTCTAGGAAAAATGCCCAAGTTGTCTTCTGTTTCTATTGTGGGA

TGTTTAAAAATGGTTTGTTGTTGTTGTTTTGGTTTCTGAAGACAGTATTGCTATATATCCCAGTCTGACCTTACTGTGTGTTTGAGGCTAACCTAGAAAT

TGAGGTGGAAAAAAAAAAAGGCCGGGCGGTGGTGGCTCACGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGTGGATTTCTAAGTTCGAGGCCAGCC

TGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAACCCTGTCTCAAAAAAAAAAAAGAAAGAAAGAAAGAAAGAGAGAAATTGAGGTGA

CCCTCCCTCAGCCTCCAGAGGACTGAGATATGTGTGTGCACCTCCCATCTCGCTCAGCACAGGGTTTCTGTGGGATGAGTTTGATTCTCTTGTTCTCACT

GCTGAACTGGTGTTTAAAATTCTTCGCAGGTCAGAAGTTTGGGAACTCAAAAGTGACATCAGGAAAGTTAGGAAAAAGTCCACTGTCAACATTATCAGCT

CTCCTCATTTCGAGCTATCTGCTAGTCACAGCTGAATAGCTTTGAGGAAGGAGGTGTGGCCCCCTCACACCCAGACACCCAGACACTTAACCACTCCTGC

AAAGCAGATAGAGCCTTCAGTTTGCCATTACCCACTGTGGTCTGCTTTTCAGCCTAGCAATTTGAGCTCTCAGCAGTGAGAAGACCCCGCCCTGCCTTCA

TTAGAGCTATCAATACTGAGTGGCTAGAACTCCAGGGACTGTGTGGGTTGCTCTGTTTTCTTACTGGAATGCCTTCTCCGGAACTGTTGCGGTTTCATTC

TCTGTCATCAGGGCTATTTTCTACAGACCTTGAGCCTCAAAACCTGTTCTACCATTGAAGGAGAGGAAGATTGAAGTTGGCTTACATTTCTACAGTGTTA

GGGGCGTAGGAGAATTGGGGCCAACATCCCATCAGAAGATTCGTGAGTCAGTGTAGTTTAGTGTCAAAGCAGCTTGTGTTGGGGCGTGTGGGACTTGAGG

ATTGGGGATTGACAGGTTTCATCATCGGATAGACATTTGGTTATCCAGAGAGAATTGGTAATTTGCCAGCGTAAGGGACCCAAAGCCACCAGTGAGTACA

TGCCCCAGAGATGGTGGCCAAGCAGAGCAGTCACCCACAAGGCAGAGTTACTCGTGAGAAAGGGCAGCAGTGTTGTGTGCATCTGTCAGTCAGGTTGTAT

GGGCTGGAGGCTGGCAGGTCTGCATGGTAGGCTGAGTTTGCTGTCCAATAGCTGTGTGACTTTGGGCAAGTCCCAGTCACCTTCCTGGCCTCACTGTCCT

CAGCTGTAACCTGGGCATTTGAGAGGTACAGGCAGAAGAGAAGACAATCATGGTCTGATTAGTTGAGTGACAGGAGTTAACAGTGATAGTGGTTTGAGCT

TTGTGTCTGTGACTCTTGTCTTCATGGAGATTCCATTCTGACCCACTTCCTCATGTCTAAACTGAAGGTGGGGTGTTTTTTTGTTGTTGTTGGTTTGGTT

TGGTTTTGGTGTTAGCTTTGTTGTTGTTCGGTTGGTTTTTGATTGTTGCATTTTTCCTGTTTCTTAGGATTGAGTTGATTGGTTTGACGTGTTTGGTTCA

GTGTCACGCACTGATACATGTTCTCTGTAATTACATGTCACCACACCAGGCTTTAGTGGCCAGGAGGGATTTGACCTTGTTCCCAAGGGATTGAGAGTCT

AGTGAGCAGCCCAGGGGCAAAGGCAGTCAACTTGCATGTGATACAAGACAGGCCAGGCAGAGCTGGTGTGACTTGAGGTGGCGCCAGCCTCTCAGGCATG

GTGGCTGGGTTGGTGATATACAGTGCAGCAGAGCTGCCCTCAGACGTGGGACTGCAGAGTCTGTTTGGATTTGACACGGGGAGTCCTTGCTGACCTCCTG

TCTCCCTAGAGCACAAACAGGAGGGGGCAAGCCCCTTGAAGGTTTGGATGGGATGAGATGGACAGTTACTGTAATGAAGGACAAAGGGAACCAGGGACGG

GGAGGAGGCATAGTCTGTGGTGACAGACAATGCTAAGGAGGGATCGCTTTGCCTGCCGGGTTCTCAAGGCTCTCTACAGGTTGCCTCTTGTACTCAGAAG

TATTAAACACTGATTATTAAACCTTC
Translation
 - UNI11964 - - UNI24558 - MN - UNI11964 - - UNI13730 - - UNI29620 - NSDQDVALKLAQERAEIVAKYDR - UNI20

674 - GREGAEIEPWEDADYLVYKVTDRFGFLH HEEELPYHNAAADR - UNI27506 - QKQLEIERTSKWLKMLKKWERYKNTEK - UNI2642

5 - FHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYS KLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYGVK KQQSLFHVLAAYSIYNT EVG

YCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHG GFFVQGFPKLLRFQEHHEKILNKFLSKLKQHL DSQEIYTSFYTMKWFFQCFLDR TPFRL

NLRIWDIYIFEGERVLTAMSYTILKLHKK KHLMKLSMEELVEFLQETLAKDFFFEDDFVIEQLQVSMAELKRAKLDLPEPG - UNI5702 - - UNI

9509 - GKEDEYPKKPLGQLPPESACVNHLSNGQRSVGRPSPKTSSRREDGSPRKNHEHSPVHHSRNGTPERAGQSRRKSVDEGSKNLKHEAESQRKPS

PGMQDSSRHYNHAAANQNSNAISNVRKEFMPKWRKPSDASAIERTTKYAVEGKSHSALPALPVAIPGSAETRLPNSRQKMKALDGGEGKRGSNASQYDNV

PGGESEHGASAEEGPERTHPHSPRKHPEPSPSPPKVPNKFTFKVQPPSHVRYPPQLPEEDHRAAYPPSYSNPPVYHGNSPKHVPTAHSGFVSTQISPRPQ

INPSRRPYGSSLSVDTSPEKAYSRPTPVVLPSSRIEVLPIDMGARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYTYRPEMHGQSWTRDAHRSHLSNL

PNYAAFQHIPFQAHGLPEVSVDSPVRYKMSAAVEDASPPGYPYAGPSPSAHHYRNGEGLSVQESVLL
Transcript ENSMUST00000091473
Sequence
GGGGGCCGTTTCCATAGCGGCGGCGGCTGGAGGTGTCGCGCCGGGGAACTTCCTGGTTCCCGGGCTCGGCTTTGCCGGGAGCCTCCTGGAAGGGAAACAA

TGGGGCGGAGGGCACTGCGGTAGCCGCCGCCGCCGCCGCGCCGGACCTCTCGGCCTCCCGCGACTGGCCGCCGCCGCCGCCGCCGGGACCGCTTGGAG -

 UNI11964 - - UNI24558 - AACAGGATATGTATTCCTCTGAGAAACCCTGGACAGCAGATCTTGGTTTAATACTGGATTGGAACAACACCCACA

GAGGTTTGCAGTCATGA - UNI11964 - - UNI13730 - - UNI29620 - ATTCCGACCAGGATGTAGCACTCAAACTTGCTCAAGAACGAGC

TGAAATAGTTGCTAAATATGACAGA - UNI20674 - GGGCGGGAAGGTGCAGAGATCGAGCCCTGGGAAGATGCTGATTATCTTGTTTACAAAGTCA

CCGATAGATTTGGCTTTTTACA TGAGGAGGAGCTCCCATACCATAATGCAGCTGCGGACCGG - UNI27506 - CAAAAGCAACTGGAAATCGAAAG

GACTTCCAAGTGGCTGAAAATGCTGAAAAAATGGGAGAGATACAAGAACACCGAGAAG - UNI26425 - TTTCATCGACGAATTTACAAAGGAATTC

CACTCCAGCTCCGAGGTGAAGTCTGGGCTCTTCTTCTTGAGATCCCTAAAATGAAAGAAGAAACAAGAGACCTTTATAGT AAATTAAAACACAGAGCAC

GGGGTTGTTCACCTGATATCAGACAAATAGACCTTGACGTGAACCGCACATTCAGGGACCATATTATGTTTAGAGACAGATACGGTGTTAA GCAACAGT

CCTTATTCCATGTTCTCGCTGCTTATTCTATCTATAATACG GAAGTCGGGTACTGCCAAGGGATGAGTCAGATCACGGCCTTGCTCCTCATGTACATGA

ACGAGGAAGACGCCTTCTGGGCCCTGGTCAAGCTCTTCTCGGGCCCCAAGCACGCAATGCACG GTTTTTTTGTCCAAGGTTTTCCTAAACTCTTGAGAT

TTCAAGAACATCATGAGAAAATTCTGAACAAATTTTTGTCCAAACTTAAGCAGCACTTG GATTCTCAAGAAATCTACACAAGTTTTTACACAATGAAAT

GGTTTTTTCAGTGTTTCCTTGATCGA ACTCCCTTCAGGCTGAACCTCAGGATATGGGACATCTATATCTTTGAAGGAGAGCGAGTCCTTACTGCTATGT

CTTACACAATCTTGAAACTACACAAAA AGCATCTGATGAAGTTGTCTATGGAAGAACTTGTAGAATTTCTTCAGGAGACTCTCGCCAAGGATTTTTTCT

TCGAGGATGATTTTGTAATAGAGCAACTTCAAGTTTCTATGGCAGAACTAAAGCGGGCAAAGTTAGATCTCCCAGAGCCTG - UNI5702 - - UNI9

509 - GTAAGGAGGATGAATATCCAAAGAAACCCTTGGGGCAGCTTCCACCTGAGTCTGCTTGTGTTAATCACTTGAGCAACGGACAAAGAAGTGTTGG

CCGGCCCAGCCCCAAAACAAGCAGCAGGAGAGAAGATGGATCGCCTCGCAAGAACCATGAGCACTCTCCTGTCCATCACAGTAGAAACGGCACACCAGAA

AGAGCCGGCCAGTCACGGCGGAAGTCCGTGGATGAGGGGAGTAAAAATCTCAAGCATGAGGCAGAGTCTCAGAGAAAACCTTCACCGGGTATGCAGGACA

GTTCCAGACACTATAACCATGCAGCTGCTAACCAAAATAGCAATGCAATTTCAAACGTCAGGAAGGAATTTATGCCCAAGTGGAGAAAACCATCAGATGC

CTCAGCTATTGAAAGAACTACTAAATATGCCGTCGAAGGCAAAAGTCACTCAGCTCTTCCCGCTCTTCCCGTCGCCATCCCAGGCTCTGCTGAGACCCGA

TTGCCAAACTCAAGGCAGAAGATGAAGGCTTTGGATGGGGGTGAAGGGAAGCGGGGTTCTAACGCTTCCCAGTATGACAACGTGCCTGGGGGTGAGAGTG

AGCATGGGGCATCTGCGGAAGAGGGACCAGAGCGGACTCACCCTCACAGTCCAAGGAAGCACCCGGAGCCAAGTCCCAGTCCTCCAAAAGTACCCAACAA

GTTTACGTTTAAAGTGCAGCCTCCCAGCCATGTACGATACCCACCCCAGCTACCAGAGGAGGACCACAGAGCTGCATATCCACCCTCCTACAGCAACCCC

CCTGTCTACCATGGAAATTCTCCAAAACACGTCCCTACTGCTCACAGTGGTTTTGTGTCTACACAGATCAGCCCCAGGCCTCAAATTAACCCTTCCAGGA

GACCTTACGGTTCCTCTCTTTCAGTTGACACTTCTCCAGAGAAAGCCTACAGCCGCCCAACTCCTGTTGTTCTGCCCTCTAGTCGAATTGAAGTCCTTCC

CATTGACATGGGTGCCAGGGGCTACGGCAGTTCGGGGTCACCAAAGAATGGACAGTTCATCCTTCCTCCGGTGGACTATTTGCCAGAGAACAGAAAATGG

TCAGAAGTTAGTTACACATACAGACCGGAGATGCATGGCCAATCATGGACTCGGGATGCTCACCGTAGCCACTTAAGCAATTTACCAAACTATGCAGCCT

TTCAGCACATACCGTTTCAGGCCCATGGCCTTCCAGAAGTGTCTGTAGACAGTCCAGTGAGGTATAAGATGTCTGCAGCTGTGGAAGATGCCAGTCCTCC

TGGGTATCCATATGCAGGGCCCTCACCTTCCGCACATCACTACAGAAATGGAGAGGGACTTTCTGTGCAGGAATCAGTGTTGCTGTGAGCGTGTGGCTGT

ATTCACTGACAAGAGAATAGAAACAATATGCCCACATTGCTATGTTTATAATTGCCAGAGCAGTATTTTTTATATTGTAAACAGCGTGCGCAGCTCAGTG

TGTGTCAGTGATAAGAGTGTGGGAAGGCTTCATCCTCTGCAGAGGCTGCTGAAGAAGAGTGGGTCAGCTGCATCCTGGCTGAACCTTTAATAGGGGACCC

TGGGGACCCAGCAGTAGCACGAGGGCTGCACACACAGGGCGGCTCTCTGTGCTGGTCCCTTCGTAGCTCCCCAGACCCGCTCTGTTCCGTTGCTGTTAGA

ACAGTAGACTACTGACCGCTATAGAGCAGATACTCTGAGGGCCGACCCTCGCCTTTTCATAGACAGACGAGGCAACTGCATATAGGTTTTGTCTTTAAAA

CCACCTTTAATCTAGATACATAGACTAACAGTGGATTTTTTTTAACCCTTTATCTTTCTGCCCACCCTGCCCAAACATATTTTAACCCAGGTTCTAAACT

GAAACTGACTAGAGATGAATCCAGCGCCTGACAGAATGTCATTCTCCTTCAGTTGCTGCCATTTTATCTCCTCCTGAAAGCTAAAGGCTCACCACTTGAT

GGTGCCTAAAGTGGGTCGGTTACCCGAGTGAGCGGCTGCACAGTGCTCACTGAGTCCCCTCATCTCCAGCAGTCTTGGTGCTGCTGTGCCCCGGGCTCTG

GTCTGGCCGGGTGTGAGGGAAGTCAGACCTTGCAGGGCCCCAGGCCGCAGAAGATTGCATTTCACAGTCGTGGGGAAGCAGCTCTAACCATAAGGAAGGC

TGCTTCTCACCCTGCTTCCCCTTCTCACAGGCTTTCTCTGGCACTCGGTCTTCACAGAGCACAGTGGGTGGATACTGCTAACACTTACTGGGCCCCGGTC

GAAATTGTGAAAAATACCCTAATGATTAATAAGGAATTTTAATCTAGAATTTTGATCTTTGTAAAAAAAGGGGAAAAAGGGTAGTTTGTTTCATACTTTT

GGAATTTTTTTTCAGTGAAAAATAACTGAAGTTCATGGTTTTTAAAAAAGGTGATGATTCCTTTTATGCTATCACACACTACTGTCACCGAGACACTGAC

AAAGTGCTGGGTTCTCCAAGAGCGATGGCGGCGTCTGTGTAGGTGCTCGCCCACCGTTACCCTCTTCTTGTATCTGAATATCAGAAACTAGAAAGTCCAA

CAGTGACACTCCCCCTGCTCCAAGGTGGGGACTTAAGTTTGTGAGGTACAAGAATATGTTTTCATGAAAGTAACATTGTTTATCTAGCAAACGTGACAAT

ATTTTTATGTATATAATGATTCTAATCTAAGTTAATTAATGTGGTAATGATGTTATTAAGTGTGGAAGCAAATGCAGTATATTAAAGGTGAACACCACAC

TGAAACTCCCAACTCCTGACAGAATAACCAGGCTCTTGATTTAGATCATGTGGAAGGTGAGATATAAATGTATATAGACATGTAGCTGAGGATATTAATT

TCAGTCTTAAAGTGTGACTTGTAAGGAGCCAAGCTGTACAGTTTAGTTCATGATGGCAGCTCTCTGCCTCTTCAGAAAGTATATATCATAGTGGTAAATA

ATGTAGATTATATATATACATATATATATATATATATGCTATATATGGACACACTATTTTCTTATGTCATCTATGGCATTTTTTTATCTGTATACTTTTT

GATGTGGTTGATTGTTTTTAACATGCTAAAAGTAATCCGTGTATTTTGTTCTGTGTCTTCTGTGTGCAGCTTCCCCGTGGCAAGTGTGTCCTGGCCTTGC

AGGGCCTGGCAGATGCACCACGGGCTCACCAGCAGCGTTTACCCACGCTGTGCTTCTCTGCTTGCATTTCCAGGGAGACCGTGTTTTGAACCGCATCACC

TTTCCTTGGCTTAAGCATTCGTTACTAATGGCAGGAAAGTCTTCCCTTCTATAAGATATATATCTCTGTTAGCTTCAAGTAGGAAATTTTAATTTAAAAT

TATTTTGCCACTATAAAATTTTATTTTAAATTTATTTTTAAATAAAAGAAATGATAAGAGAAATAA
Translation
 - UNI11964 - - UNI24558 - ETLDSRSWFNTGLEQHPQRFAVMN - UNI11964 - - UNI13730 - - UNI29620 - NSDQDVALK

LAQERAEIVAKYDR - UNI20674 - GREGAEIEPWEDADYLVYKVTDRFGFLH HEEELPYHNAAADR - UNI27506 - QKQLEIERTSKWLKM

LKKWERYKNTEK - UNI26425 - FHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYS KLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYGVK

 KQQSLFHVLAAYSIYNT EVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHG GFFVQGFPKLLRFQEHHEKILNKFLSKLKQHL DSQEIY

TSFYTMKWFFQCFLDR TPFRLNLRIWDIYIFEGERVLTAMSYTILKLHKK KHLMKLSMEELVEFLQETLAKDFFFEDDFVIEQLQVSMAELKRAKLDL

PEPG - UNI5702 - - UNI9509 - GKEDEYPKKPLGQLPPESACVNHLSNGQRSVGRPSPKTSSRREDGSPRKNHEHSPVHHSRNGTPERAGQSR

RKSVDEGSKNLKHEAESQRKPSPGMQDSSRHYNHAAANQNSNAISNVRKEFMPKWRKPSDASAIERTTKYAVEGKSHSALPALPVAIPGSAETRLPNSRQ

KMKALDGGEGKRGSNASQYDNVPGGESEHGASAEEGPERTHPHSPRKHPEPSPSPPKVPNKFTFKVQPPSHVRYPPQLPEEDHRAAYPPSYSNPPVYHGN

SPKHVPTAHSGFVSTQISPRPQINPSRRPYGSSLSVDTSPEKAYSRPTPVVLPSSRIEVLPIDMGARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYT

YRPEMHGQSWTRDAHRSHLSNLPNYAAFQHIPFQAHGLPEVSVDSPVRYKMSAAVEDASPPGYPYAGPSPSAHHYRNGEGLSVQESVLL

For any suggestions or comments, please send an email to unitrap@crg.es