Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039063 (Echdc3)
Chromosomal location
Chr 2: 6109511 - 6134040 (-)
Description
enoyl Coenzyme A hydratase domain containing 3 Gene [Source:MGI (curated);Acc:Echdc3-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35032
Vector Insertion
Chr 2: 6116628 - 6127559
Public Clones IST12742A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114941
Sequence
CTTGCTTTTCTTGGCTGCAATGGCTGTGGTCGCAGGCCTTCGGGCCTTTGGGGTGAAGTGGCCCAGCTGGCTCAGGCGCAACCCATGGGCCCCTCTCTCC

GCCGGCTTCTGCAGCCCAGGGTCAGCAGGACCTGCGGGGTCGGAGTCAGAGCCAAGGCTCACCAGCACGCGACAGCAGGACGGAATCAG GAACATTGTC

TTAAGCAATCCCAGGAGGAGGAATGCGCTGTCACTGGCCATGCTGAAATCTCTCCGAAGTGACATTCTTCACGAAGCTGAAAGTGAAGACCTGAAAGTCA

TTATAATTTCAG - UNI35032 - CCGAGGGCCCTGTGTTTTCATCTGGACATGATTTGAAAGAGCTGACAGATGCACAAGGCCGTGATTATCACGCT

GAGGTATTTCAGACCTGTTCTGAGGTAAGCCAGGGTGAGGGCCAGCAGGGTGAGCATGGAAGCTGGTATTGTATTAAATACAGAGGTAGCTTTCTCGTCT

CAGATAAGAGTCTATCCACGGGGTCTGCTCACCGGAAAGGTGGGTGTCGGAAGCTTTGTAGTTATTGGTAAGTCCTTCAGCCAAGCAATTACTGGGTTTA

GACTGTTAAAGAATAGCCGTGCTAGCTGGGGAGATGGCTCAGTGGTTAGAGCGCTTCCTGTGCAACCGTGGGGACCTGCGTTTGGATTCCTAGCTTCCAT

GTGAGACACTGCGTGGCCACAGATATCTGTGGGCATGCAGACACAGAAGACCCAGACAGCCAGAAACCCCTGAGTTCTTGGTTCAGGGAGAGACTCTGAC

TTAAGGGAGTCGGACTGAATGATAGAGCAGGAC
Translation
MAVVAGLRAFGVKWPSWLRRNPWAPLSAGFCSPGSAGPAGSESEPRLTSTRQQDGIR RNIVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISA

 - UNI35032 - AEGPVFSSGHDLKELTDAQGRDYHAEVFQTCSEVSQGEGQQGEHGSWYCIKYRGSFLVSDKSLSTGSAHRKGGCRKLCSYW
Transcript ENSMUST00000042658
Sequence
GCTTGCACAGTCAACCTTGCTTTTCTTGGCTGCAATGGCTGTGGTCGCAGGCCTTCGGGCCTTTGGGGTGAAGTGGCCCAGCTGGCTCAGGCGCAACCCA

TGGGCCCCTCTCTCCGCCGGCTTCTGCAGCCCAGGGTCAGCAGGACCTGCGGGGTCGGAGTCAGAGCCAAGGCTCACCAGCACGCGACAGCAGGACGGAA

TCAG GAACATTGTCTTAAGCAATCCCAGGAGGAGGAATGCGCTGTCACTGGCCATGCTGAAATCTCTCCGAAGTGACATTCTTCACGAAGCTGAAAGTG

AAGACCTGAAAGTCATTATAATTTCAG - UNI35032 - CCGAGGGCCCTGTGTTTTCATCTGGACATGATTTGAAAGAGCTGACAGATGCACAAGGC

CGTGATTATCACGCTGAGGTATTTCAGACCTGTTCTGAG - UNI35032 - GTCATGATGCTGATCCGGAACCACCCGGTCCCCATCCTTGCCATGGT

CAATGGCTTGGCCACAGCTGCAGGCTGCCAGCTCGTGGCCAGCTGTGATATTGCTGTGGCAAGTGACAAGTCTTCTTTTGCAACTCCTGGAGTGAATGTT

GGACTTTTCTGCTCCACCCCCGCGGTCGCCCTGGGGAGAGCAGTGCCCAGAAAG - UNI35032 - GTGGCCCTGGAGATGCTCTTTACTGGGGAGCC

CATTTCTGCCCAGGAGGCCTTGCGCCATGGCCTTATCAGCAAAGTGGTACCAGAGGAACAGCTGGAGGCAGAGACCATGAGAATAGCAAAGAAGATTTCC

TCTTTGAGCCGCTCTGTGGTGGCGTTGGGCAAGGCCACCTTTTACAAACAGCTGCCACAAGACCTTAGAACCGCCTACTTCCTCGCCTCCCAGGCCATGG

TAGACAACCTGGCCTTGCAGGATGGGCAGGAAGGAATTGAAGCCTTCATCCAGAAGAGAAAGCCCATCTGGTCACACTGAGCCCGCATGAGGAGTGCTGA

GTTAATGGTCAGCCCTAGCTGACCCCCAGCCCTCCCATCTCCTCCTCTCAACCCAACCATATACTGCCACCTCTTGATTGTAAGAGAACATTGCCAGCCT

TTCTAACTTGGATGTTGGTTTCTCAGTGTGTGATCTGTATTGAATGCCATGGTTCTGTGGGAAATGAATACAGGGGAGGGAACGACTTGCTAGGTCAGTG

GGCAGGTTAATATGCACTGGGGTGTGCAGGCTGTGACAGAAACCCCAGTACCCAACGGAGCCTGAAGTGAGGTGCTGCCCATACAGAGGACAGTCAAGTG

AAGCGTGAAGGAAGGGTGCCGCCCCCATGCTTCTGCAGTGTCCTTCAGGCACAGTCCGTTCTGGTTGTTCATGGCAAGTTGAACAGTTCAAATCTCCATG

AGACCATCTCCCCACTGAAAAATTTCTTGATTCTACCAGGAAATCATCACACCTGTAGTTTGGAATAATCTTATGTGATTTGAATAAATTAAATATTTAT

AGAGCTGGGTCATTTCATTTCTAACCCACCGCAAGCTAAGAAAAGAAAAGAGAGAATATTCTCTTTGTATGTCCACTCTGATGGGCACAAAGCAAGGGCC

TTGCCCTCACTACTAAACCAGAGGATAAAAGCTGCCCAGAACAGGGCAAGGACCCAGAGCAGACCCCATCCAATGAGAGTCGCTTCCTCAGGACACAGTT

CAGAACTGTGCTCAGCTTCTGGTAATAAACCCAGACTAAACTCATATTTAGACCTAGTCATATTTTTTTGGCATCTGGTCTAATGTAGCCCAAAGAGTGT

TCAAATTTTCTGTGCCTGTAAACTTGACCATAAATCAATATCCATCTATCCTCCT
Translation
MAVVAGLRAFGVKWPSWLRRNPWAPLSAGFCSPGSAGPAGSESEPRLTSTRQQDGIR RNIVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISA

 - UNI35032 - AEGPVFSSGHDLKELTDAQGRDYHAEVFQTCSE - UNI35032 - VMMLIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDK

SSFATPGVNVGLFCSTPAVALGRAVPRK - UNI35032 - VALEMLFTGEPISAQEALRHGLISKVVPEEQLEAETMRIAKKISSLSRSVVALGKATF

YKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKRKPIWSH

For any suggestions or comments, please send an email to unitrap@crg.es