Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039065 (Fam173b)
Chromosomal location
Chr 15: 31531876 - 31547273 (+)
Description
family with sequence similarity 173, member B Gene [Source:MGI Symbol;Acc:MGI:1915323]
RefSeq_dna
NM_026546 
RefSeq_peptide
NP_080822.1 
MGI
MGI:1915323 
Uniprot/SWISSPROT
Q9D1Z3 
Human Ortholog
ENSG00000150756 (FAM173B)
Omim not available
UniTrap UNI37755
Vector Insertion
Chr 15: 31531905 - 31535665
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27489
Vector Insertion
Chr 15: 31539372 - 31546625
Public Clones not available
Private Clones OST58309 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042702
Sequence
CTCCCCGGAACGCGCGATGGAGCGAGTAG - UNI37755 - GAACGCCTGAGGAAGAAAGACAGGCGGGCCCTGTTCTTCCTACGAGTCTGGAATCCG

ACAGTTCAAAGAGGACCAGTTGGGGATTCTTGATTACTGGGGTCGTTGGTGGTGCACTGCTGACAGTGTATGCTGTGGCCACACCATTCATCACCCCGGC

CCTCCGGAAAGTTTGTTTGCCATTCGTGCCTGCAACTTCGAAGCAGGTTGAAAATGTTGTCAGGATGCTGCGACACAGAAGAGGACCCCTGGTGGACATC

GGCAGTGGCGATGGGCGGATT GTGATTGCAGCTGCAAAGGAAGGCTTCCCAGCGGTGGGGTATGAATTGAATCCATGGCTGGTTTGGTACTCCAGATAT

CGTGCCTGGAGGGCAGGCGTGCATGGCTCTGCCAAGTTTTATATTTCAGATCTCTGGAAG GTCACCTTTGCACAGTACTCCAATGTTGTCATTTTTGGT

GTGCCCCAGATG - UNI27489 - ATGCCACAGCTGGAGAAGAAGCTTGAGCTGGAGCTGGAGGACGGAGCTCGAGTCATTGCCTGTCGGTTCCCGTT

CCCACGCTGGACTCCAGACCACACCACTGGAGAGGGCATCGACACCGTGTGGGCCTATGACATGAGTGCTCAGAGAGGACGGGGAGGACGGCCGAATCAG

GAGTGGGTCGGCCAGAAGAACCTCTCGGAGACAGCAGGCCTGCAGGCCTCCTCATCTGAGACACGGAGCAAGCTCCTTGACGTTGAGTGACAAGTCACCG

CTGCTAATCTTCCGTTCTTGAGAAAATGAACAGAACTCAGAGAAGCATTTAAGTTTAAGCTCTGCTGCTTTTTGAAGGGCAGTTTCACACGGCCTGGGGT

GGCCTTGCACTTACTGAGCACGATGACCCGGAACTTCTGATCCTTCCACTTCTACCTGCCCAGTAAAAGGTGCTCCTAGTGGGACATCCTGGATAGGGTG

CATGAAGATATAAGTAAGGGACCGTCTGTCTGTGGGTCAGAAGGTATCATCTCAGCAGCATGGTTTAATGGCTCGGGTGAAGAGGGCAGGGCACTTAGGC

AAACACCTGCAGTTTCCTGTGGTTTTGTCCATGACTGAATTTCTGTAGTGTGTAGCTAAATTAAATTTCTAAAG
Translation
MERVG - UNI37755 - GTPEEERQAGPVLPTSLESDSSKRTSWGFLITGVVGGALLTVYAVATPFITPALRKVCLPFVPATSKQVENVVRMLRHRRG

PLVDIGSGDGRI VIAAAKEGFPAVGYELNPWLVWYSRYRAWRAGVHGSAKFYISDLWK VTFAQYSNVVIFGVPQM - UNI27489 - MPQLEKKLE

LELEDGARVIACRFPFPRWTPDHTTGEGIDTVWAYDMSAQRGRGGRPNQEWVGQKNLSETAGLQASSSETRSKLLDVE

For any suggestions or comments, please send an email to unitrap@crg.es