Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039108 (Lsm14b)
Chromosomal location
Chr 2: 179759891 - 179769361 (+)
Description
LSM14 homolog B (SCD6, S. cerevisiae) Gene [Source:MGI (curated);Acc:Lsm14b-002]
RefSeq_peptide
NP_808395.2 
UniGene
Mm.21577 
MGI
MGI:3040677 
Uniprot/SWISSPROT
Q8CGC4 
Uniprot/SPTREMBL
A2AC71 Q3TS70 Q8BM41 Q4KL69 
Human Ortholog
ENSG00000149657 (LSM14B)
Omim not available
UniTrap UNI1539
Vector Insertion
Chr 2: 179760018 - 179761102
Public Clones CC0271 (sanger) IST14841G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055485
Sequence
ATGAGCGGCTCGTCCGGCACCCCGTATCTGGGCAGCAAGATCAGCCTCATCTCCAAGGCGCAGATCCGCTATGAGGGCATCCTCTACACCATCGACACCG

ACAACTCCACCGTGGCGCTCGCCAAAG - UNI1539 - TGAGGTCCTTTGGTACTGAAGACCGTCCCACAGACAGGCCTGCTCCCCCAAGAGAGGAAA

TTTATGAGTACATCATTTTCCGGGGAAGTGATATCAAGGATATTACTGTGTGCGAACCTCCAAAAGCTCAACATACACTCCCTCAGGATCCTGCTATTGT

TCAG TCCTCCCTGGGCTCTGCCTCCGCCTCGCCCTTCCAGCCGCATGTGCCTTACAGCCCCTTCAGAGGGATGCCACCGTATGGCCAGCTGGCAGCCAG

TTCCCTGCTCAGCCAGCAGTATGCCGCTTCCTTAGGTCTAG GAGCTGGGTTCCCATCTACCCCAGTCGGCAAGAGCCCCATGGTGGAGCAGGCTGTCCA

GACTAGTTCTGTTGATAACTTGAATGCTAAGAAACTGTTGCCCAGCAAGGTCACCTCGGCGACACAGCTCAATGGTCGCCAGGCTCAGCCAAGCAGCAAG

CCTGCCAGCG ATGTAGTCCAGCCGGCACCTGTGCACACTCAAGGGCAGGTGAATGATGAGAACAGAAGACCTCCACGGAGGCGGTCAG GCAATCGGAG

AACAAGAAATCGTTCCAGAGGACAAAACCGTCCAACTAACGTTAAGGAAAACACAATCAAGTTTGAAGGTGACTTTGATTTTGAGAGTGCAAATGCCCAG

TTCAACCGAGAGGAGCTTGATAAAGAGTTTAAGAAGAAACTGAATTTTAAAG ATGACAAAGCCGACAAGGGGGAAGAGAAGGACCCAGCTGTGATGGCG

CAGAGTGAAGAGACTGCTGCTGAGGAGGATCTTCTGGGGCCTAACTGTTACTATGACAAGTCCAAGTCCTTCTTTGACAACATCTCTTCTGAACTCAAAA

CCAG TTCTAGGCGGACAACATGGGCTGAAGAGAGAAAGCTGAACACTGAGACTTTTGGAGTGTCAGGGAGGTTCCTTCGTGGCCGCAGTTCACGTGGTG

GATTCCGGGGAGGCAGAGGAAATGGGACAACACGGCGCAACCCCACTTCCCACCGAGCTGGGACTGGCCGGGTATAAGGGTGCAGTACAA GGTCCAGCA

GAGGCAGAGGTGCTGCCCTGAAGATAAGGACAGAAGGCAACACTACAGTCAGCAGGAGAAGTGAACCTTGTGTACCAGCCTGGAAACCCTCATACTGCTA

CTTAGTTTGGACTTAACCTAACTTGGACATGGTCTGAGATTTAGAACCACTTGGTTTTGGGGAAGTATTTGTAGGTGACCTCTGAAGGTTTCTCGACCTA

CATTTCCTTCTTGGTTGCACACAGCCTAATAGTAAGGTTTTGGTATTTTGCAAAAAGGTTTCTATAGGCAAAGGCTCAATCCTCACTTTGTAACTTTTTT

TTTTTTAATGACCGCTTTGACTCTTAAAATGGAACCAAATTTTATTTGGC
Translation
MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKV - UNI1539 - VRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQ

HTLPQDPAIVQ SSLGSASASPFQPHVPYSPFRGMPPYGQLAASSLLSQQYAASLGLG GAGFPSTPVGKSPMVEQAVQTSSVDNLNAKKLLPSKVTSAT

QLNGRQAQPSSKPASD DVVQPAPVHTQGQVNDENRRPPRRRSG GNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKD

 DDKADKGEEKDPAVMAQSEETAAEEDLLGPNCYYDKSKSFFDNISSELKTS SSRRTTWAEERKLNTETFGVSGRFLRGRSSRGGFRGGRGNGTTRRNP

TSHRAGTGRV 
Transcript ENSMUST00000058764
Sequence
AGAGGGCTTTCACAGATTATCAGGGAACTTTGTGAAGCTTGGGATTCTACGGGAATTCTCATGTCAATTCCTGAACTACTGTCCCTTGTGGTCTTTGCCA

CATGGTGCTGTATAGGTATTGTCAGCGAGCTCGAGTAGCTGTTAGTTGTGAAGAGAGTGCTGTGTCAGAGGGCACTCTCTGTAGTCAGAAGCTTGGCCCA

GGACAACAAGTTAACTGTCGTTTTCTCAACCCCTAAGTGAGGTCCTTTGGTACTGAAGACCGTCCCACAGACAGGCCTGCTCCCCCAAGAGAGGAAATTT

ATGAGTACATCATTTTCCGGGGAAGTGATATCAAGGATATTACTGTGTGCGAACCTCCAAAAGCTCAACATACACTCCCTCAGGATCCTGCTATTGTTCA

G TCCTCCCTGGGCTCTGCCTCCGCCTCGCCCTTCCAGCCGCATGTGCCTTACAGCCCCTTCAGAGGGATGCCACCGTATGGCCAGCTGGCAGCCAGTTC

CCTGCTCAGCCAGCAGTATGCCGCTTCCTTAGGTCTAG AGAAGTTGGTAAGCCCTCCAGCCTCAGCCGCTGCTTCCAGCCCTAGTTCTTCTCCATCTCC

ACAGCCTGTTTCAGAGCTTGACATGTCCTCAGAGCCACCTCAGCTCACTTGCAAGG GAGCTGGGTTCCCATCTACCCCAGTCGGCAAGAGCCCCATGGT

GGAGCAGGCTGTCCAGACTAGTTCTGTTGATAACTTGAATGCTAAGAAACTGTTGCCCAGCAAGGTCACCTCGGCGACACAGCTCAATGGTCGCCAGGCT

CAGCCAAGCAGCAAGCCTGCCAGCG ATGTAGTCCAGCCGGCACCTGTGCACACTCAAGGGCAGGTGAATGATGAGAACAGAAGACCTCCACGGAGGCGG

TCAG GCAATCGGAGAACAAGAAATCGTTCCAGAGGACAAAACCGTCCAACTAACGTTAAGGAAAACACAATCAAGTTTGAAGGTGACTTTGATTTTGAG

AGTGCAAATGCCCAGTTCAACCGAGAGGAGCTTGATAAAGAGTTTAAGAAGAAACTGAATTTTAAAG ATGACAAAGCCGACAAGGGGGAAGAGAAGGAC

CCAGCTGTGATGGCGCAGAGTGAAGAGACTGCTGCTGAGGAGGATCTTCTGGGGCCTAACTGTTACTATGACAAGTCCAAGTCCTTCTTTGACAACATCT

CTTCTGAACTCAAAACCAG TTCTAGGCGGACAACATGGGCTGAAGAGAGAAAGCTGAACACTGAGACTTTTGGAGTGTCAGGGAGGTTCCTTCGTGGCC

GCAGTTCACGTGGTGGATTCCGGGGAGGCAGAGGAAATGGGACAACACGGCGCAACCCCACTTCCCACCGAGCTGGGACTGGCCGGGTATAAGGGTGCAG

TACAA GGTCCAGCAGAGGCAGAGGTGCTGCCCTGAAGATAAGGACAGAAGGCAACACTACAGTCAGCAGGAGAAGTGAACCTTGTGTACCAGCCTGGAA

ACCCTCATACTGCTACTTAGTTTGGACTTAACCTAACTTGGACATGGTCTGAGATTTAGAACCACTTGGTTTTGGGGAAGTATTTGTAGGTGACCTCTGA

AGGTTTCTCGACCTACATTTCCTTCTTGGTTGCACACAGCCTAATAGTAAGGTTTTGGTATTTTGCAAAAAGGTTTCTATAGGCAAAGGCTCAATCCTCA

CTTTGTAACTTTTTTTTTTTTAATGACCGCTTTGACTCTTAAAATGGAACCAAATTTTATTTGGC
Translation
 MPPYGQLAASSLLSQQYAASLGLE EKLVSPPASAAASSPSSSPSPQPVSELDMSSEPPQLTCKG GAGFPSTPVGKSPMVEQAVQTSSVDNLNAKKLL

PSKVTSATQLNGRQAQPSSKPASD DVVQPAPVHTQGQVNDENRRPPRRRSG GNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEF

KKKLNFKD DDKADKGEEKDPAVMAQSEETAAEEDLLGPNCYYDKSKSFFDNISSELKTS SSRRTTWAEERKLNTETFGVSGRFLRGRSSRGGFRGGRG

NGTTRRNPTSHRAGTGRV 
Transcript ENSMUST00000094250
Sequence
AGAGGGCTTTCACAGATTATCAGGGAACTTTGTGAAGCTTGGGATTCTACGGGAATTCTCATGTCAATTCCTGAACTACTGTCCCTTGTGGTCTTTGCCA

CATGGTGCTGTATAGGTATTGTCAGCGAGCTCGAGTAGCTGTTAGTTGTGAAGAGAGTGCTGTGTCAGAGGGCACTCTCTGTAGTCAGAAGCTTGGCCCA

GGACAACAAGTTAACTGTCGTTTTCTCAACCCCTAAGTGAGGTCCTTTGGTACTGAAGACCGTCCCACAGACAGGCCTGCTCCCCCAAGAGAGGAAATTT

ATGAGTACATCATTTTCCGGGGAAGTGATATCAAGGATATTACTGTGTGCGAACCTCCAAAAGCTCAACATACACTCCCTCAGGATCCTGCTATTGTTCA

G TCCTCCCTGGGCTCTGCCTCCGCCTCGCCCTTCCAGCCGCATGTGCCTTACAGCCCCTTCAGAGGGATGCCACCGTATGGCCAGCTGGCAGCCAGTTC

CCTGCTCAGCCAGCAGTATGCCGCTTCCTTAGGTCTAG GAGCTGGGTTCCCATCTACCCCAGTCGGCAAGAGCCCCATGGTGGAGCAGGCTGTCCAGAC

TAGTTCTGTTGATAACTTGAATGCTAAGAAACTGTTGCCCAGCAAGGTCACCTCGGCGACACAGCTCAATGGTCGCCAGGCTCAGCCAAGCAGCAAGCCT

GCCAGCG GCAATCGGAGAACAAGAAATCGTTCCAGAGGACAAAACCGTCCAACTAACGTTAAGGAAAACACAATCAAGTTTGAAGGTGACTTTGATTTT

GAGAGTGCAAATGCCCAGTTCAACCGAGAGGAGCTTGATAAAGAGTTTAAGAAGAAACTGAATTTTAAAG ATGACAAAGCCGACAAGGGGGAAGAGAAG

GACCCAGCTGTGATGGCGCAGAGTGAAGAGACTGCTGCTGAGGAGGATCTTCTGGGGCCTAACTGTTACTATGACAAGTCCAAGTCCTTCTTTGACAACA

TCTCTTCTGAACTCAAAACCAG TTCTAGGCGGACAACATGGGCTGAAGAGAGAAAGCTGAACACTGAGACTTTTGGAGTGTCAGGGAGGTTCCTTCGTG

GCCGCAGTTCACGTGGTGGATTCCGGGGAGGCAGAGGAAATGGGACAACACGGCGCAACCCCACTTCCCACCGAGCTGGGACTGGCCGGGTATAAGGGTG

CAGTACAA GGTCCAGCAGAGGCAGAGGTGCTGCCCTGAAGATAAGGACAGAAGGCAACACTACAGTCAGCAGGAGAAGTGAACCTTGTGTACCAGCCTG

GAAACCCTCATACTGCTACTTAGTTTGGACTTAACCTAACTTGGACATGGTCTGAGATTTAGAACCACTTGGTTTTGGGGAAGTATTTGTAGGTGACCTC

TGAAGGTTTCTCGACCTACATTTCCTTCTTGGTTGCACACAGCCTAATAGTAAGGTTTTGGTATTTTGCAAAAAGGTTTCTATAGGCAAAGGCTCAATCC

TCACTTTGTAACTTTTTTTTTTTTAATGACCGCTTTGACTCTTAAAATGGAACCAAATTTTATTTGGC
Translation
 MPPYGQLAASSLLSQQYAASLGLG GAGFPSTPVGKSPMVEQAVQTSSVDNLNAKKLLPSKVTSATQLNGRQAQPSSKPASG GNRRTRNRSRGQNRPT

NVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKD DDKADKGEEKDPAVMAQSEETAAEEDLLGPNCYYDKSKSFFDNISSELKTS SSRRTTWA

EERKLNTETFGVSGRFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV 

For any suggestions or comments, please send an email to unitrap@crg.es