Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039115 (Itga9)
Chromosomal location
Chr 9: 118515827 - 118808057 (+)
Description
integrin alpha 9 Gene [Source:MGI Symbol;Acc:MGI:104756]
RefSeq_dna
NM_133721 
RefSeq_peptide
NP_001106986.1 NP_598482.2 
UniGene
Mm.335520 
MGI
MGI:104756 
Uniprot/SPTREMBL
Q3UT74 Q80V97 Q8BJG9 Q91YD5 
Human Ortholog
ENSG00000144668 (ITGA9)
Omim not available
UniTrap UNI20582
Vector Insertion
Chr 9: 118716434 - 118741851
Public Clones not available
Private Clones OST358061 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25019
Vector Insertion
Chr 9: 118759925 - 118778408
Public Clones IST14725A7 (tigm) IST14996E6 (tigm) IST12102F8 (tigm) IST14314B12 (tigm)
IST10037D3 (tigm) IST11063C6 (tigm) IST10046A8 (tigm) IST12101F9 (tigm)
Private Clones OST197971 (lexicon) OST68065 (lexicon) OST50578 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044165
Sequence
CGGGCCCGGGACCCGCTCCTTCCGAGAGCGCAGACCTCTCGGCGGGCATCGAGAGGACGCGGGGCGCTGGCGGCCGTCCCTGGCCTTGCTCCGGCTCTCG

CTGTAGCCCATCGCCGCGTCCCGGGCTTAGACTCGGAGCGTACGGCTCCCGCCCCGGGCAGCGGCGTGTCCCGGGAGCCCCGATCGCGGGGCAGGGCGCA

GGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGCTGCGGCGCGGACCGGCGCCGGAGGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGCCGCGGGGGTCCCG

GCCGGCGCCTACAACCTGGACGCGCAGCGCCCGGTACGCTTCCAGGGCCCCTCAGGCTCCTTCTTCGGCTACGCGGTGCTGGAGCACTTCCACGACAACA

CGCGCTG GGTCCTCGTGGGTGCACCGAAGGCAGATTCTAAATATAGCACTTCAGTAAAGTCTCCTGGAGCTGTGTTTAAGTGTCGTGTCCATACCAACC

CTGACCGGAGATGCACCGAGCTGGACATGGCTCGAG GGAGGACTCGTGGTGCGCCCTGTGGGAAGACCTGCAGGGGAGACCGGGATGACGAGTGGATGG

GGGTGAGCCTGGCCCGGCAGCCCAGAGCAGATGGCCGTGTTTTG GCCTGTGCCCATCGTTGGAAGAACATCTACTACGAAGCAGACCACATCCTGCCCC

ATGGATTCTGCTACCTCATCCCTTCCAACCTCCAGGCCAAAGGCAAGGTGCTGATTCCCTGCTACGAAG AGTATAAGAAGAAGTATGGGGAAGAACATG

GCTCCTGCCAGGCCGGAATAGCAGGCTTCTTCACAGAG GAACTGGTGGTCATGGGTGCCCCAGGCTCGTTTTATTGGGCTGGGACACTCAAGGTGCTGA

ACCTCACGGACAACACATATTTTAAGTTGAACGATGAAGCGATTATGAACAGACGGTATACTTATCTGG GCTATGCAGTGACGGCTGGCCACTTCTCTC

ATCCATCCATCACTGATGTGGTAGGGGGTGCCCCACAGGATGAAGGCATTGGAAAG GTTTATATATTTAGAGCTGACCGAAGATCAGGGACCTTAATAA

AGATCTTTCAGGCATCAGGAAAAAAG ATGGGCTCTTACTTCGGCTCCTCCTTGTGTGCAGTCGACCTGAACATGGACGGCCTCTCTGACTTGCTCGTGG

GGGCTCCCATGTTTTCTGAGATCAGAGATGAGGGGCAGGTCACCGTCTACCTCAACCAAGGACAT GGAGCCCTCGAGGAACAGCTGACCCTGACTGGAG

ATGCCGCCTACAACGCGCACTTTGGGGAGAGCATCGCCAACCTGGGCGACATTGATGATGACGGGTTCCCAG ATGTGGCTGTCGGGGCACCTAAGGAGG

AGGACTTTGCTGGCGCAGTCTACATCTATCATGGTGATGCCAATGGGATTGTCCCCAAGTACTCAATG AAGCTGTCTGGGAGGAGGCTAAACCCGACCC

TGCGGATGTTTGGGCAGTCCATATCAGGGGGCATTGATATGGATGGAAATGGCTATCCTG ATGTCACCATCGGAGCCTTCCTGTCCGACAGCGTGGTTC

TCCTCAG GGCCAGACCGGTCATCACGGTGGATGTCTCCATCTTCCTGCCAGGCTCCATCAACATCACAGCACCTCAGTGTCACGATGGACAACAGCCTG

TGAACTGCCTGAATGTCACCGTGTGCTTCCGGTTCCATGGCAAGAATGTACCAGGAGAAATCG GTCTGAACTACAATCTGACGGCTGATGTGGCACAGA

AGGAGAAGGGCCAGCTGCCCAGAGTCTATTTTGTGTTGTTTGGAGAGACGGCAGGGCAGGTCTCAGAAAGGCTGCAGCTGTCCCACATGGACGAAGTGTG

TCATCACTACGTGGCCCACGTCAAG CGGAGAGTCCAGGATGTCATCAGCCCCATTGTGTTTGAAGCCGCCTACAGCCTGGATGAGCATGTGATGGGTGA

GGAAGACCGGGAGCTGCCAGACCTGACACCAGTGCTTCGCTGGAAGAAGGGACAAAGGATCTCCCAGAAGAATCAG ACAGTTTTTGAAAGGAATTGCCA

ATCTGAGGACTGTGCTGCCGACCTGCAGCTTCGGGGGAAACTCCTGCTTTCCAG TGTTGACGAGAAAACCCCACACCTGGCTTTGGGGGCTGTGAAAAA

TATCTCTCTAAACATCTCCATCTCCAACCTTGGAGACGACGCCTATGATGCCAACGTGTCCTTTAATGTCTCCAGGGAACTTTTCTTCATCAACATGTGG

CAGAAG - UNI20582 - GAGGAGATGGGCATTTCCTGTGAGCTGCTGGAATCAGACTTCCTCAAGTGCAGTGTGGGATTTCCTTTCATGAGGTCAAA

GTCTAAG TATGAATTCAGTGTCATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAATTCTCAGCTTCATCGTGACTGCTCAGAG TGGCAACTTGG

AGCGCTCTGAAGCCCTGCATGACAACACTCTCACACTGACAGTGCCCCTGGTGCATGAAGTGGACACGTCCATCACTGG AATTGTGTCCCCAACCTCCT

TCGTGTATGGCGAGTCTGTGGACGCATCCAACTTCATTCAGCTGGATGACCAGGAGTGTCATTTCCAACCAGTCAACATTACTCTCCAG GTCTACAACA

TGGGTCCCAGCACCCTTCCTGGGTCATCTGTCAGCATCTCCTTCCCCAGCCGGCTGTCACCTGGTGGCGCAGAGATGTTTCAGGTCCAGGACATGGTG -

 UNI25019 - GTGAGCCAAGAGAAGGGTAACTGCTCTCTACAAAGAAACCCGACCCCCTGCATCATCCCTCAAGAACAAGAGAACATCTTCCACACCA

TATTTGCTTTCTTCTCCAAGTCTGGAAGAAAAGTGTTG GACTGTGAAAAGCCAGGGAGCTTCTGCCTAACGTTGCACTGCAACCTTAGTGCTCTTCCGA

AAGAGGAGAGCCGCACCATCAACCTATACATGCTACTGAACACAGAGATACTGAAGAAG GACAGCTCCTCTGTCATCCAGTTCATGGCTCGAGCCAAGG

TGAAGGTGGAGCCTGCCCTGAGAGTGGTGGAGATAGCTAACGGGAACCCAGAAGAGACTCTG GTGGTCTTCGAGGCCTTGCACAATCTGGAACCCCGTG

GCTACGTTGTGGGGTGGATCATCGCCATCAGTTTGCTGGTGGGGATCCTCATTTTTCTGCTGCTGGCTGTGCTCCTGTGGAAG ATGGGCTTCTTCCGCA

GAAGGTACAAAGAGATCATTGAAGCTGAGAAAAACCGGAAAGAGAATGAAGATGGTTGGGACTGGGTCCAGAAAAACCAGTGACCCACCGTGCCAGTCAT

GTGATGCCCTCATGTCCCCATCACCAGCCTGTGGTCCTTGATCTTTGTATCTTTCATATTTGGAAGAAAGAAATCTTCTCCAGATTTTTCGGAGGCCCCA

CTGATGCTGTTCTCTTCCTCATCCCGTCAAGCCCGGTGCCGACCTGAGATGGCCACCCCTCCAGCCAGGTCACATGACTGGGGCCACCACCACTCCCCTT

CGCAAGATGAACTTAGAACTTTGGAAAGGCAAGCTACAGAGCAAAGCAATATTTATGGATGCAACATTGCGTGGTCAACCCTCAGGGGAAAACTGTTACC

TAAAAGTATTTTTTATAAATGTAAGCCTTTTATATTGATCATGTCTTTATATTTGTATCAATGTTTTATTATTTCTATTAAATAGTTCTATAATTCACTC

AAGCACTGAAATCTTGGAAATACATGTCCCTGCATACAAATTTTAAAAGAGAAGGAACTTATTCTACTTTGGAACTTGTTGTTAGGGAAGAAAAAAAAAA

CTTGCAGATAAAACAAACTGAAGAAACCTCATGAAATGAATCCACCAAGCTGGAGGCACTGGGAAAGCACAAAGGACATGGCAAGGCCGCCTAAGACATT

TATTCCCCATTGTTACCACCCGGAGTTAAGTTCAGAGAGCTTGAAGTATCGGTGTTTTCTCTTATGGACCTCTCACTGGGAGATTCTCAGCAGGAACTGG

GATGGAAAGCTTGGTTTCCTCTCAGCAGTTGCTCTGTACCACACTGATACATGCAGCAGGCACTAAACCCTCTTCTGGAGTCAGCAAGTGCTGGATGGAC

AACTGGTCAACCTCAGAATAGCATCTCATCCTAAACAACATGTGTCAGAGTTCAGAGCCCAGGACCGAAGCTGTGCTCTCTCAGCAAAGGCCTGTTTTCT

CTGTGTGTAAGCTGTTACCTTGTGGTATAATGTTAACACAAGACTCTCCATTTCCTCTGTCACTCTTGCTGTCCCCAACTGGTGGTGCTGCAGATACCTC

CCCAGAGAGGATCACCCCACATGGTTTGTGTTTATGTCTTAGGTGGAATTCTCAAGAGTCGAACCCTGAAATAGGACTTGGGTGTAAATAATTTATTGAG

GAAGTCTTCCCAGAAGGTAACAGTGAGGAAGTTGAGAATACAAGACAGGAGAGTACAGGGAGCCAGGCAACAGTGTCCTTTCAGGGGACAACCCACGAGG

TGGCTTCAAACCAGTTGGATCTAATGAGCAAGTCAGACTCAGGAACCTGGACTTTTGTGATGCCACGCCTGCAGGGGATATAAACTTTCTGCCCTTAGGT

CTTGCTGACAAGATGACTCTGTCCTCTAGAGGAGAACTTTGGGGGGCACCCTCAAGTAAGGAGATCCACAAATCATGCAAAGAACTCTGAGCCAAGAGCT

TTAGTGCTCCCCTCCCCCACACAAGTGAATGCTACCTTCAGCTTTGTGTAGCCAAAAAAGCCATGAGTCTAAGCTGGTCCTAGGAGTCAAACATTACATC

TGACCCATGACCAAGTCAAACTCACTACAAGGAAGGGGCAGCCCCCCCAAAAAAAAAAACAGTGCACACCCAGCTCTTTTAAGTTTTATC
Translation
MGGPAAARTGAGGLRALLLALVAAGVPAGAYNLDAQRPVRFQGPSGSFFGYAVLEHFHDNTRW WVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRC

TELDMARG GRTRGAPCGKTCRGDRDDEWMGVSLARQPRADGRVL ACAHRWKNIYYEADHILPHGFCYLIPSNLQAKGKVLIPCYEE EYKKKYGEEHG

SCQAGIAGFFTE ELVVMGAPGSFYWAGTLKVLNLTDNTYFKLNDEAIMNRRYTYLG GYAVTAGHFSHPSITDVVGGAPQDEGIGK VYIFRADRRSGT

LIKIFQASGKK MGSYFGSSLCAVDLNMDGLSDLLVGAPMFSEIRDEGQVTVYLNQGH GALEEQLTLTGDAAYNAHFGESIANLGDIDDDGFPD DVAV

GAPKEEDFAGAVYIYHGDANGIVPKYSM KLSGRRLNPTLRMFGQSISGGIDMDGNGYPD DVTIGAFLSDSVVLLR RARPVITVDVSIFLPGSINITA

PQCHDGQQPVNCLNVTVCFRFHGKNVPGEIG GLNYNLTADVAQKEKGQLPRVYFVLFGETAGQVSERLQLSHMDEVCHHYVAHVK RRVQDVISPIVFE

AAYSLDEHVMGEEDRELPDLTPVLRWKKGQRISQKNQ TVFERNCQSEDCAADLQLRGKLLLSS SVDEKTPHLALGAVKNISLNISISNLGDDAYDANV

SFNVSRELFFINMWQK - UNI20582 - EEMGISCELLESDFLKCSVGFPFMRSKSK YEFSVIFDTSHLSGEEEILSFIVTAQS SGNLERSEALHD

NTLTLTVPLVHEVDTSITG GIVSPTSFVYGESVDASNFIQLDDQECHFQPVNITLQ VYNMGPSTLPGSSVSISFPSRLSPGGAEMFQVQDMV - UNI

25019 - VSQEKGNCSLQRNPTPCIIPQEQENIFHTIFAFFSKSGRKVL DCEKPGSFCLTLHCNLSALPKEESRTINLYMLLNTEILKK DSSSVIQF

MARAKVKVEPALRVVEIANGNPEETL VVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWK MGFFRRRYKEIIEAEKNRKENEDGWDWVQKNQ


For any suggestions or comments, please send an email to unitrap@crg.es