Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039126 (A230083H22Rik)
Chromosomal location
Chr 19: 17197459 - 17296299 (+)
Description
BNIP2 motif-containing molecule at the C-terminal region 1  [Source:UniProtKB/Swiss-Prot;Acc:Q52KR3]
UniGene
Mm.411071 Mm.257354 
MGI
MGI:2443750 
Uniprot/SWISSPROT
Q52KR3 
Human Ortholog
ENSG00000106772 (KIAA0367)
Omim not available
UniTrap UNI34554
Vector Insertion
Chr 19: 17200194 - 17211253
Public Clones IST15006E9 (tigm) IST12508H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13002
Vector Insertion
Chr 19: 17211382 - 17242752
Public Clones (sanger) D059C02 (ggtc) E126D06 (ggtc) CMHD-GT_353C3-3 (cmhd) FHCRC-GT-S19-9H1 (fhcrc)
FHCRC-GT-S8-7D1 (fhcrc) FHCRC-GT-S12-3H1 (fhcrc) FHCRC-GT-S7-9F1 (fhcrc)
FHCRC-GT-S17-5E1 (fhcrc) FHCRC-GT-S17-9D1 (fhcrc) FHCRC-GT-S10-2D1 (fhcrc)
FHCRC-GT-S7-9B1 (fhcrc) FHCRC-GT-S13-5G1 (fhcrc) FHCRC-GT-S10-12B1 (fhcrc)
IST11530E6 (tigm) IST12603G11 (tigm) IST11995F8 (tigm) IST11409G5 (tigm)
IST14567C1 (tigm) IST14860G1 (tigm) IST14416E4 (tigm) IST11534E6 (tigm)
Private Clones OST457232 (lexicon) OST456610 (lexicon) OST434900 (lexicon) OST434105 (lexicon)
OST428396 (lexicon) OST427269 (lexicon) OST425307 (lexicon) OST424225 (lexicon)
OST422517 (lexicon) OST418055 (lexicon) OST407004 (lexicon) OST371102 (lexicon)
OST353658 (lexicon) OST350883 (lexicon) OST350617 (lexicon) OST339417 (lexicon)
OST327847 (lexicon) OST318628 (lexicon) OST315212 (lexicon) OST314804 (lexicon)
OST312294 (lexicon) OST310839 (lexicon) OST310372 (lexicon) OST289034 (lexicon)
OST288050 (lexicon) OST281730 (lexicon) OST272037 (lexicon) OST270035 (lexicon)
OST266831 (lexicon) OST262348 (lexicon) OST262038 (lexicon) OST261489 (lexicon)
OST259806 (lexicon) OST253303 (lexicon) OST251743 (lexicon) OST250994 (lexicon)
OST250961 (lexicon) OST244002 (lexicon) OST237954 (lexicon) OST231568 (lexicon)
OST217979 (lexicon) OST217864 (lexicon) OST214341 (lexicon) OST211219 (lexicon)
OST206945 (lexicon) OST205625 (lexicon) OST202965 (lexicon) OST200436 (lexicon)
OST194244 (lexicon) OST192480 (lexicon) OST191797 (lexicon) OST191080 (lexicon)
OST181225 (lexicon) OST172924 (lexicon) OST171748 (lexicon) OST171151 (lexicon)
OST168277 (lexicon) OST167972 (lexicon) OST157164 (lexicon) OST149946 (lexicon)
OST143284 (lexicon) OST141056 (lexicon) OST134996 (lexicon) OST133863 (lexicon)
OST129570 (lexicon) OST118934 (lexicon) OST95899 (lexicon) OST85984 (lexicon)
OST79835 (lexicon) OST78211 (lexicon) OST63708 (lexicon) OST56850 (lexicon)
OST54973 (lexicon) OST37522 (lexicon) OST35774 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16356
Vector Insertion
Chr 19: 17242833 - 17253279
Public Clones (sanger) E036C07 (ggtc) E129G11 (ggtc)
Private Clones OST462456 (lexicon) OST456548 (lexicon) OST456547 (lexicon) OST430032 (lexicon)
OST424136 (lexicon) OST413225 (lexicon) OST277515 (lexicon) OST240445 (lexicon)
OST232766 (lexicon) OST226933 (lexicon) OST217946 (lexicon) OST184405 (lexicon)
OST172528 (lexicon) OST128864 (lexicon) OST127407 (lexicon) OST124309 (lexicon)
OST119082 (lexicon) OST118538 (lexicon) OST76512 (lexicon) OST73844 (lexicon)
OST66089 (lexicon) OST64420 (lexicon) OST63748 (lexicon) OST58280 (lexicon)
OST55830 (lexicon) OST44609 (lexicon) OST38752 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21447
Vector Insertion
Chr 19: 17253481 - 17267745
Public Clones not available
Private Clones OST329954 (lexicon) OST314645 (lexicon) OST237902 (lexicon) OST208981 (lexicon)
OST207215 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28663
Vector Insertion
Chr 19: 17290864 - 17295273
Public Clones not available
Private Clones OST24087 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099594
Sequence
TCACGTGACCAGAAAATGGAGGCGAATCTGTACTTGGTGTTAACTGCTCCAGAAGGGAGATGCTGAAGCGCCAGAACCGCGCATCTTTCTGTTCCTCTCG

CTAGCAAGCCTCCTGTCACCCTCAGAAG - UNI13002 - ACCCCCGTCAGAGGATGAAGGAATGGATATCCACTTCGAGGAGGGAGTGCTGAGTCCC

AGTGCCGCAGACATGAGGCCCG - UNI16356 - AACCTCCCAATTCTCTGGATCTCAATGGCAGTCACCCTAGAAGAATCAAGCTCACAGCCCCAAA

TATCAACCTCTCTCTGGACCAAAGTGAAGGATCTATTCTCTCTGATGATAACCTAGACAGTCCGGATGAGATTGACATCAATGTGGATGAACTCGATACC

CCTGATGAAGCAGACTCTTTTGAATATACTAACCATG - UNI21447 - AAGATCCCACGGCCAACAAAAGCTCTGGTCAAGAGTCAGAGTCTATTCC

AGAATATACGGCTGAAGAGGAGCGAGAAGACAACCGGCTGTGGAGGACGGTGGTCATCGGGGAGCAGGAGCAACGGATTGACATGAAGGTCATTGAACCC

TACAGGAGAGTCATTTCTCACGGAG GATACTATGGGGACGGTCTGAATGCCATCATTGTGTTTGCTGCCTGCTTTCTGCCAGACAGCAGCCGGGCGGAT

TACCACTATGTCATGGAAAACCTTTTCCT ATATGTAATAAGTACCTTAGAGCTGATGGTTGCTGAAGACTACATGATCGTGTACTTAAATGGTGCAACC

CCAAGGCGGAAGATGCCAGGACTAGGTTGGATGAAGAAATGCTACCAGATGATTGACAGACG GTTGCGCAAGAATTTGAAGTCATTCATCATTGTTCAC

CCATCTTGGTTCATCAGGACAATCTTAGCAGTGACTCGGCCTTTTATAAG CTCTAAATTCAGCAGTAAAATTAAATATGTGACTAGCTTATCTGAGCTC

AGTGGCCTGATCCCCATGGACTGCATCCACATTCCAGAGAGCATCATCAA - UNI28663 - CATTGACATGAAGCTGAAGGAGAAGCCGTAGCTGGC

CTGCTGGAGGAGGACTCCCTTTCTGCTTGGTGATTTTGCTGGGACGTACCTACCTGGAAGCAACAGGGATGGTGACATCTCCACTTTGCACCACCTGGTG

CCATTGGAAACTTTCAAGGAAAAGAGAATTTGTTTACTGTTAACATATCCTATGAAATGTTGTGTCTTTTCCTATTTTGCCAATTACGTGCCTCAATGAT

TTTAGTTGAACCTTAGCAACTAAACCTTCCGTTTAGTTTTATGGACCTTCCATTTTTACTATTATGCTAATCTTCGGTGCAGTGGGACTTGGTTCCTTAG

ACTGGTTTTTACCAAAAGCATAGCCTAGTTCTGCTGTTAGACAGATGTGGATATGTTTCTGTAGACTGACTGAATCCCTACAGAGCTTCCTTCTAGATTC

AGGATGCACAGGGCTTGCCTTGTCCCAGGAACATGGCTTTCTGGAACTCTATGAAATGCTGAACTTGAATAGGACAGACAGACAGATATAAAATCCTCAT

CAGCTAAGGCATCTGCCCCCTTCCTGTCCACATCTTTCAGTTTTTCAAAAGGACCCGGGCTTTCTAACCCATGCAAGCTTTACTTTATATTTCTGCATGT

AAATTGCTCTTTTACAACATCATCTTCTAGTGAGCTTTGAAGAACTGCATCTTGTGAAACTTAAGACGAGCTATGCTTCAGGCCACAGAACAGGCTCCAA

CCTTTACACTTCGTCCAACTCCAAGGTGGCCCACTGAGAAATCACTGGGTAACATCGAATCGTCCAAAATTAACACTCAGATGCATTGCAAAAGCAATCT

GCTTGAGGAAGTTTAAAATTAAATACAAGTATATACTAGCCTTTATGAAATAGCTCATTTCTTGTTTTTTATATGCCCCTAAATTGTTACGGCAATTTCC

AGTCTGTGGATCTCCAGCAGAGGTTGGCAAGCTGTACCGAGGAGGCTAAGGCTCCAAAGCAAGAGAAGGTGGCTTCCACACTTACAGTTG
Translation
 - UNI13002 - MDIHFEEGVLSPSAADMRPE - UNI16356 - EPPNSLDLNGSHPRRIKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDE

LDTPDEADSFEYTNHE - UNI21447 - EDPTANKSSGQESESIPEYTAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRRVISHGG GYYGDGLNAI

IVFAACFLPDSSRADYHYVMENLFL LYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRR RLRKNLKSFIIVHPSWFIRTILAVTRPF

IS SSKFSSKIKYVTSLSELSGLIPMDCIHIPESIIN - UNI28663 - NIDMKLKEKP
Transcript ENSMUST00000044176
Sequence
TCACGTGACCAGAAAATGGAGGCGAATCTGTACTTGGTGTTAACTGCTCCAGAAGGGAGATGCTGAAGCGCCAGAACCGCGCATCTTTCTGTTCCTCTCG

CTAGCAAGCCTCCTGTCACCCTCAGAAG - UNI13002 - ACCCCCGTCAGAGGATGAAGGAATGGATATCCACTTCGAGGAGGGAGTGCTGAGTCCC

AGTGCCGCAGACATGAGGCCCG - UNI16356 - AACCTCCCAATTCTCTGGATCTCAATGGCAGTCACCCTAGAAGAATCAAGCTCACAGCCCCAAA

TATCAACCTCTCTCTGGACCAAAGTGAAGGATCTATTCTCTCTGATGATAACCTAGACAGTCCGGATGAGATTGACATCAATGTGGATGAACTCGATACC

CCTGATGAAGCAGACTCTTTTGAATATACTAACCATG - UNI21447 - AAGATCCCACGGCCAACAAAAGCTCTGGTCAAGAGTCAGAGTCTATTCC

AGAATATACGGCTGAAGAGGAGCGAGAAGACAACCGGCTGTGGAGGACGGTGGTCATCGGGGAGCAGGAGCAACGGATTGACATGAAGGTCATTGAACCC

TACAGGAGAGTCATTTCTCACGGAG GAGACTCAG GATACTATGGGGACGGTCTGAATGCCATCATTGTGTTTGCTGCCTGCTTTCTGCCAGACAGCAG

CCGGGCGGATTACCACTATGTCATGGAAAACCTTTTCCT ATATGTAATAAGTACCTTAGAGCTGATGGTTGCTGAAGACTACATGATCGTGTACTTAAA

TGGTGCAACCCCAAGGCGGAAGATGCCAGGACTAGGTTGGATGAAGAAATGCTACCAGATGATTGACAGACG GTTGCGCAAGAATTTGAAGTCATTCAT

CATTGTTCACCCATCTTGGTTCATCAGGACAATCTTAGCAGTGACTCGGCCTTTTATAAG CTCTAAATTCAGCAGTAAAATTAAATATGTGACTAGCTT

ATCTGAGCTCAGTGGCCTGATCCCCATGGACTGCATCCACATTCCAGAGAGCATCATCAA ACTGGATGAAGAACTGAGGGAGGCATCCGAAGCAGCTAA

 AACTAGCTGCCTTTACAATGATCCAGAAATGTCTTCTATGGAAAAGGA - UNI28663 - CATTGACATGAAGCTGAAGGAGAAGCCGTAGCTGGCC

TGCTGGAGGAGGACTCCCTTTCTGCTTGGTGATTTTGCTGGGACGTACCTACCTGGAAGCAACAGGGATGGTGACATCTCCACTTTGCACCACCTGGTGC

CATTGGAAACTTTCAAGGAAAAGAGAATTTGTTTACTGTTAACATATCCTATGAAATGTTGTGTCTTTTCCTATTTTGCCAATTACGTGCCTCAATGATT

TTAGTTGAACCTTAGCAACTAAACCTTCCGTTTAGTTTTATGGACCTTCCATTTTTACTATTATGCTAATCTTCGGTGCAGTGGGACTTGGTTCCTTAGA

CTGGTTTTTACCAAAAGCATAGCCTAGTTCTGCTGTTAGACAGATGTGGATATGTTTCTGTAGACTGACTGAATCCCTACAGAGCTTCCTTCTAGATTCA

GGATGCACAGGGCTTGCCTTGTCCCAGGAACATGGCTTTCTGGAACTCTATGAAATGCTGAACTTGAATAGGACAGACAGACAGATATAAAATCCTCATC

AGCTAAGGCATCTGCCCCCTTCCTGTCCACATCTTTCAGTTTTTCAAAAGGACCCGGGCTTTCTAACCCATGCAAGCTTTACTTTATATTTCTGCATGTA

AATTGCTCTTTTACAACATCATCTTCTAGTGAGCTTTGAAGAACTGCATCTTGTGAAACTTAAGACGAGCTATGCTTCAGGCCACAGAACAGGCTCCAAC

CTTTACACTTCGTCCAACTCCAAGGTGGCCCACTGAGAAATCACTGGGTAACATCGAATCGTCCAAAATTAACACTCAGATGCATTGCAAAAGCAATCTG

CTTGAGGAAGTTTAAAATTAAATACAAGTATATACTAGCCTTTATGAAATAGCTCATTTCTTGTTTTTTATATGCCCCTAAATTGTTACGGCAATTTCCA

GTCTGTGGATCTCCAGCAGAGGTTGGCAAGCTGTACCGAGGAGGCTAAGGCTCCAAAGCAAGAGAAGGTGGCTTCCACACTTACAGTTG
Translation
 - UNI13002 - MDIHFEEGVLSPSAADMRPE - UNI16356 - EPPNSLDLNGSHPRRIKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDE

LDTPDEADSFEYTNHE - UNI21447 - EDPTANKSSGQESESIPEYTAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRRVISHGG GDSG GYYGD

GLNAIIVFAACFLPDSSRADYHYVMENLFL LYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRR RLRKNLKSFIIVHPSWFIRTILA

VTRPFIS SSKFSSKIKYVTSLSELSGLIPMDCIHIPESIIK KLDEELREASEAAK KTSCLYNDPEMSSMEKD - UNI28663 - DIDMKLKEKP
Transcript ENSMUST00000087689
Sequence
ATGCTGTCTGTCTGGGACCGTGCAGAACCAGCATTAACTCACAGAGATGAAAATGGATGTGTTAGCACTGGGGTTTCACCCACTGAGTGCCAACAAGAGA

ACCAGTGGGAACCAGAAAAACCCTATCTCAGCCACGTGACACATTCAAGCACTCCCACAGAAAATGCCCTCGAGAGCAATGCCCCCACACAACTGATGAG

GAAGCTGGACTCTGATTGGAATAGCCCCAGCCCCAGCGAACCCCAACATAACTTTGTTCCAGATATTTTACATGGCAACTTCGAAGAGGGTGGGCAGCTG

GCCTCGGCGTCACCTGATTTGTGGATGGATGTCAAGCAACCCTTCAGTTTTAAAGTAGATAGCGAGAATCCTGATATATTGACTCACTGTGACCATGACA

GCAACTCTCAGGCATCCAGCAGCCCTGACGTGTGCCACGATTCTGAAGGGGAGCAAAAGATGGAGAAGCATACTGCTGTTTACCTGGGACTTGAAGTGGA

ACCCAGTGAGTTTTCTCTCACCGAGCCAAACATGAATGATGAACCAACTTGGGAACCTGAGCAGGAAAGTCTCCCACACAATTCAGAACTCCATTCCGAA

CACGCAATGCCCTTGCCTCCAATCGACAGTCAGAATGATATAAATAACTCATCTAAGCCTGCCTCTTCAAGAAGTTCCCCAGAACCCTCTGATATGCGCG

GAGACAACAACACAAGTGTAACATCGATGGAAGAAGACACCAACCCAGAGGTAGAAGCAGTGGACAGCGTGACGATCCCAGGTCACTTCCCCAGAAGTGA

AGACGCTGACACTTTTGAAGCTCACCAAGAGGTCAGTGTGGAAGTCGACGACTCTTGGGTGTCAAAAGACCTTTGTCCTGAAAGTCAGACAGGCACTAGA

GCTCTGCTTGACTGTGAGCAACCGTTTGCTTCCGAGAGCCCTGCTGTACTTACGGACATCTTCCTAACCTCAGACACCTGCCTGGATGTAAGCGAAGCTG

CCTTGGATCACAGTTTCAGTGATGCCTCCGGCCTCAACACTTCCACAGGCACTATAGACGACATGAGTAAGCTGACTCTATCGGAAGGCCATCCCGAAAC

ACCAGTTGACGGGGATGCAGGGAAGCAAGATGTCTGTTCATCTGAAGCTTCCTGGGGTGATTTTGAATATGATGCAATGGGTCAGAATATTGACGAAGAG

CTGATGAGAGAGCCTGAACACTTCCTCTATGGTGGTGATCTTCCGTCAGAGGAAAGCGCGCTGAAGCAATCACTGACACCATACACACCCCCCTTTGATT

TGTCCTATCTCACGGAACCTACTGGATGCACTGAAACTGCACAGGGAGCTGAGTCTCCAGGTGATGAATCTCTGGGAAGTGACGCGGCAGAGATGTTGCT

TTCTGCTCTTCCAGATCACAGGGAGGAAGACAAGGCTGAGACCAACATCAGGAAACCTAGATACCAGATGACTGTGTTGCATATTCATGAAGACCCTGAG

GCTCTTTCATCACCTGTGGGAGGAACAGGTTCCAATAATGAGTCATCTCCATCAAACATTGACTGGGAAATAGAAACAGATAATTCAGATTCACCAGCAG

GTGGCGACATGAAACCACCAAACG GCAAGGAGATACTGGAGTTAGAAGAAGATGAGAAAGTAATTCCCACGAAAGGGCCAAAGCAAACAGAATTAGAAT

ACAAAGAAGAAAAACAGCCAGAGCAAAGTGAAGACCATCAGGTACTAGCTGTGGACTACATCCTTGTAAGCCATGAAAAAGATTCACCATTGAAACCAGA

GGCCAGGGAAGCAAGAGAAAACATACCCGAATTGGAACAATTATCCATAGGTTCCAGAGAAACAGGGCTACCAGAGACTCAGTTATCAGGCACCCCAGAC

ACATGTCAGTCTGAGTTTTTAAATGATGTCAAAGTTCATTCTGCAGAGAGAATGTCTTCGTCTTCCAACCACGAGAGTGCATCTCTTGAAAACCCTGCAC

AAGACCAGAGTTGGATGGTCTTGAGCCATAGTGAGGTTGGTGACCCGCCTACAGAAACCAGGGACTCGGGGCCTGAGTCTCCTGGTAGAACTCCGGAGCC

GTTCTTGAGTCTCAGTTTGGACAAGGGCCCCAAGTCCCAGGTTCTGGAAAGAAATAAGCCTCTAAATTCTTTAGCACTAGAGGAAGTTGCTGGTTTGAGC

AGCCAATCAAGGAACATCGAGAGACAAGGTCAAGCTGGTCTAGATGCAGTTCCAACCCAGGCGGCCACCCACGACAATGAATGGGAAATGCTTTCGCCAC

AGCTCTCCCGGAAAAACAGGAACCCTCCACAGGAAATGGAAGAAGAGACACAGTGCCCTGAGCCTGGACCCAGAAAGCCAAGACTGAAAGG - UNI130

02 - - UNI34554 - ACCCCCGTCAGAGGATGAAGGAATGGATATCCACTTCGAGGAGGGAGTGCTGAGTCCCAGTGCCGCAGACATGAGGCCCG -

 UNI16356 - AACCTCCCAATTCTCTGGATCTCAATGGCAGTCACCCTAGAAGAATCAAGCTCACAGCCCCAAATATCAACCTCTCTCTGGACCAAAG

TGAAGGATCTATTCTCTCTGATGATAACCTAGACAGTCCGGATGAGATTGACATCAATGTGGATGAACTCGATACCCCTGATGAAGCAGACTCTTTTGAA

TATACTAACCATG - UNI21447 - AAGATCCCACGGCCAACAAAAGCTCTGGTCAAGAGTCAGAGTCTATTCCAGAATATACGGCTGAAGAGGAGCG

AGAAGACAACCGGCTGTGGAGGACGGTGGTCATCGGGGAGCAGGAGCAACGGATTGACATGAAGGTCATTGAACCCTACAGGAGAGTCATTTCTCACGGA

G GATACTATGGGGACGGTCTGAATGCCATCATTGTGTTTGCTGCCTGCTTTCTGCCAGACAGCAGCCGGGCGGATTACCACTATGTCATGGAAAACCTT

TTCCT ATATGTAATAAGTACCTTAGAGCTGATGGTTGCTGAAGACTACATGATCGTGTACTTAAATGGTGCAACCCCAAGGCGGAAGATGCCAGGACTA

GGTTGGATGAAGAAATGCTACCAGATGATTGACAGACG GTTGCGCAAGAATTTGAAGTCATTCATCATTGTTCACCCATCTTGGTTCATCAGGACAATC

TTAGCAGTGACTCGGCCTTTTATAAG CTCTAAATTCAGCAGTAAAATTAAATATGTGACTAGCTTATCTGAGCTCAGTGGCCTGATCCCCATGGACTGC

ATCCACATTCCAGAGAGCATCATCAA GTATGATGAAGAGAAATCTTTTAAGAGAAGTGTGAG ACTGGATGAAGAACTGAGGGAGGCATCCGAAGCAGC

TAA AACTAGCTGCCTTTACAATGATCCAGAAATGTCTTCTATGGAAAAGGA - UNI28663 - CATTGACATGAAGCTGAAGGAGAAGCCGTAGCTG

GCCTGCTGGAGGAGGACTCCCTTTCTGCTTGGTGATTTTGCTGGGACGTACCTACCTGGAAGCAACAGGGATGGTGACATCTCCACTTTGCACCACCTGG

TGCCATTGGAAACTTTCAAGGAAAAGAGAATTTGTTTACTGTTAACATATCCTATGAAATGTTGTGTCTTTTCCTATTTTGCCAATTACGTGCCTCAATG

ATTTTAGTTGAACCTTAGCAACTAAACCTTCCGTTTAGTTTTATGGACCTTCCATTTTTACTATTATGCTAATCTTCGGTGCAGTGGGACTTGGTTCCTT

AGACTGGTTTTTACCAAAAGCATAGCCTAGTTCTGCTGTTAGACAGATGTGGATATGTTTCTGTAGACTGACTGAATCCCTACAGAGCTTCCTTCTAGAT

TCAGGATGCACAGGGCTTGCCTTGTCCCAGGAACATGGCTTTCTGGAACTCTATGAAATGCTGAACTTGAATAGGACAGACAGACAGATATAAAATCCTC

ATCAGCTAAGGCATCTGCCCCCTTCCTGTCCACATCTTTCAGTTTTTCAAAAGGACCCGGGCTTTCTAACCCATGCAAGCTTTACTTTATATTTCTGCAT

GTAAATTGCTCTTTTACAACATCATCTTCTAGTGAGCTTTGAAGAACTGCATCTTGTGAAACTTAAGACGAGCTATGCTTCAGGCCACAGAACAGGCTCC

AACCTTTACACTTCGTCCAACTCCAAGGTGGCCCACTGAGAAATCACTGGGTAACATCGAATCGTCCAAAATTAACACTCAGATGCATTGCAAAAGCAAT

CTGCTTGAGGAAGTTTAAAATTAAATACAAGTATATACTAGCCTTTATGAAATAGCTCATTTCTTGTTTTTTATATGCCCCTAAATTGTTACGGCAATTT

CCAGTCTGTGGATCTCCAGCAGAGGTTGGCAAGCTGTACCGAGGAGGCTAAGGCTCCAAAGCAAGAGAAGGTGGCTTCCACACTTACAGTTG
Translation
MLSVWDRAEPALTHRDENGCVSTGVSPTECQQENQWEPEKPYLSHVTHSSTPTENALESNAPTQLMRKLDSDWNSPSPSEPQHNFVPDILHGNFEEGGQL

ASASPDLWMDVKQPFSFKVDSENPDILTHCDHDSNSQASSSPDVCHDSEGEQKMEKHTAVYLGLEVEPSEFSLTEPNMNDEPTWEPEQESLPHNSELHSE

HAMPLPPIDSQNDINNSSKPASSRSSPEPSDMRGDNNTSVTSMEEDTNPEVEAVDSVTIPGHFPRSEDADTFEAHQEVSVEVDDSWVSKDLCPESQTGTR

ALLDCEQPFASESPAVLTDIFLTSDTCLDVSEAALDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDAGKQDVCSSEASWGDFEYDAMGQNIDEE

LMREPEHFLYGGDLPSEESALKQSLTPYTPPFDLSYLTEPTGCTETAQGAESPGDESLGSDAAEMLLSALPDHREEDKAETNIRKPRYQMTVLHIHEDPE

ALSSPVGGTGSNNESSPSNIDWEIETDNSDSPAGGDMKPPNG GKEILELEEDEKVIPTKGPKQTELEYKEEKQPEQSEDHQVLAVDYILVSHEKDSPLK

PEAREARENIPELEQLSIGSRETGLPETQLSGTPDTCQSEFLNDVKVHSAERMSSSSNHESASLENPAQDQSWMVLSHSEVGDPPTETRDSGPESPGRTP

EPFLSLSLDKGPKSQVLERNKPLNSLALEEVAGLSSQSRNIERQGQAGLDAVPTQAATHDNEWEMLSPQLSRKNRNPPQEMEEETQCPEPGPRKPRLKG 

- UNI13002 - - UNI34554 - GPPSEDEGMDIHFEEGVLSPSAADMRPE - UNI16356 - EPPNSLDLNGSHPRRIKLTAPNINLSLDQSEG

SILSDDNLDSPDEIDINVDELDTPDEADSFEYTNHE - UNI21447 - EDPTANKSSGQESESIPEYTAEEEREDNRLWRTVVIGEQEQRIDMKVIEP

YRRVISHGG GYYGDGLNAIIVFAACFLPDSSRADYHYVMENLFL LYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRR RLRKNLKS

FIIVHPSWFIRTILAVTRPFIS SSKFSSKIKYVTSLSELSGLIPMDCIHIPESIIK KYDEEKSFKRSVR RLDEELREASEAAK KTSCLYNDPEMSS

MEKD - UNI28663 - DIDMKLKEKP

For any suggestions or comments, please send an email to unitrap@crg.es