Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039156 (Stim2)
Chromosomal location
Chr 5: 54389762 - 54512296 (+)
Description
stromal interaction molecule 2 Gene [Source:MGI (curated);Acc:Stim2-001]
RefSeq_dna
NM_001081103 
RefSeq_peptide
NP_001074572.1 
UniGene
Mm.397177 Mm.401540 Mm.404062 Mm.468739 Mm.265985 
MGI
MGI:2151156 
Uniprot/SWISSPROT
P83093 
Uniprot/SPTREMBL
Q8BIM2 A5CVE4 Q8C4Z8 B2RQE3 
Human Ortholog
ENSG00000109689 (STIM2)
Omim not available
UniTrap UNI1310
Vector Insertion
Chr 5: 54389808 - 54390274
Public Clones DC0127 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31491
Vector Insertion
Chr 5: 54390274 - 54444614
Public Clones IST10921E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20575
Vector Insertion
Chr 5: 54444746 - 54466518
Public Clones not available
Private Clones OST358272 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33092
Vector Insertion
Chr 5: 54466634 - 54493813
Public Clones IST14291H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113841
Sequence
GCCAGTATGCAGAGCAGGAACTGGAGCAG GTCCGCATGG CTAAAAAAGGCCGAAAAGGAGTTTGAACTGAGAAGCAGCTGGTCTGTCCCTGACGCACT

ACAGAAATGGCTTCAGCTAACACACGAAGTTGAAGTACAGTACTACAATATTAAGAGGCAAAATGCTGAGATGCAGCTAGCCATCGCTAAGGACGAG GC

AGAAAAAATTAAAAAGAAGAGAAGCACAGTCTTTGGGACCCTGCACGTTGCACACAGCTCCTCCCTGGACGAAGTAGACCACAAGATTCTGGAAGCCAA 

CTGGGTGGTGATGCCTAGAGTCTCCATTCCACCCTACCCTATTGCTGGAGGAGTTGATGACCTCGATGAAGACACACCCCCAATCGTGCCACAGTTTCCA

G GGACCGTGGCTAAACCTGCAGGATCTTTAGCCAGAAGCAGTAGTTTATGCCGCTCTCGTCGCAGCATCGTGCCATCCTCCCCACAGTCTCAGCGAGCT

CAGCTTCCTGCTCATGCTCCTCTGGCAGCCCACCCTCGGCACCCTCACCATCCGCAGCATCCCCAGCACTCGTTGCCTTCCCCAGATCCAGACATCCTGT

CTGTGTCAAGTTGCCCTGCTCTGTATCGGAACGAAGAGGAGGAGGAGGCTATCTACTTCACTGCTGAGAAACAATG GGAAGTGCCAGACACAGCTTCAG

AATGTGACTCCTTAAACTCTTCCAGTGGGAGAAAACCGTCTCCCCCTTCAAGCCTTGAGATGTACCAAACATTGTCTTCCCGAAAAATCTCAAGAGACGA

GCTTTCCCTGGAGGACTCTTCCAGGGGGGAGTCACCCGTGACAGCAGATGTCTCCCGGGGCTCCCCTGAGTGTGTGGGTCTGACGGAGACCAAGAGCATG

ATCTTCAGCCCTGCAAGCAGAGTGTACAATGGCATCCTGGAGAAATCCTGCAGCATGCACCAGCTCTCCAGCGGCATCCCGGTGCCTCATCCCCGACACA

CATCGTGCTCCTCAGCCGGCAATGATAGCAAGCCAGTTCAGGAAGCCTCGAATGTTTCCAGAGTAAGCAGCATCCCACATGACCTCTGTCATAATGGTGA

GAAAAGCAAAAAGCCATCCAAAATCAAAAGCCTTTTCAAGAAGAAGTCTAAGTGA
Translation
ASMQSRNWSR RSAW LKKAEKEFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDE AEKIKKKRSTVFGTLHVAHSSSLDEVDHKIL

EAN NWVVMPRVSIPPYPIAGGVDDLDEDTPPIVPQFPG GTVAKPAGSLARSSSLCRSRRSIVPSSPQSQRAQLPAHAPLAAHPRHPHHPQHPQHSLPS

PDPDILSVSSCPALYRNEEEEEAIYFTAEKQW WEVPDTASECDSLNSSSGRKPSPPSSLEMYQTLSSRKISRDELSLEDSSRGESPVTADVSRGSPECV

GLTETKSMIFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEASNVSRVSSIPHDLCHNGEKSKKPSKIKSLFKKKSK
Transcript ENSMUST00000071083
Sequence
CGCGGCGGCGGCGCGGGCGCTGGGCTGGGGCTTGGCCGCGCCAGAGCAGCGGATCCCGGTGTCGCCGCGGCAGCTGCGCGGGTGTCGCGCTGGGTCGGAA

GACGCCGTACCACTGCGCTCCCCCACTTTTTTTTTTTTTTTTTTTTTTAAATAACCGGAACCAATGAACGCGGCGGCGAGCCGAGCTTCGCGGGCCGCCG

GTGAAGGGAGCGGGTCAGCACCCGGCGGGAGTCCGCTTCCGAGGCGGCCGGGCCCCGGGCAGCTGGCGGTGAGCGAGTGGCCGGCGGCTCCTGTGAGCGC

TCCTCCCGCCGTGGCACCGGGCCGGGCCTCGGGCCGCCCTCTCCGGCGGCGCTGGGCAGCAATGCTGCTCTTCGGGTTGTTGGTGGCCGGCGTGGCGGAC

GGATGCGATCTGGTGCCCCGGCACCTCCGCGGGCGGCGCGCGTCGGGATCGGCCGGAGCGGCGGCGTCTCCTTCGGCTGCGGCTGCGGGCGAGCGCCAGG

CGCTGCTGACAG - UNI1310 - - UNI31491 - ATCCCTGTATGTCGCTGAGTCCACCTTGCTTCACTGAAGAAGACAGGTTTAGCTTGGAAGCA

CTTCAGACAATACACAAACAGATGGACGACGACAAGGACGGCGGGATCGAAGTGGACGAGAGTGATGAG - UNI20575 - TTTATCAGAGAAGATAT

GAAATATAAAGATGCTACGAATAAACATAGTCACCTGCACAGAGAAGATAAGCACATAACTGTTGAGGATTTGTGGAAACAGTGGAAAACATCAGAAG -

 UNI33092 - TTCACAATTGGACACTTGAGGATACCCTGCAGTGGTTAATAGAATTTGTTGAACTGCCACAATATGAGAAGAATTTTAGGGATAATAA

TGTGAAGGGAACAACACTCCCCAG GATAGCAGTTCATGAAACTTCATTTATGATTTCCCAGTTGAAAATCAGCGACCGAAGTCACAGACAGAAACTCCA

ACTCAAAGCCCTGGATGTGGTTCTGTTTGGGCCTCTGACAC GCCCACCTCATAACTGGATGAAGGATTTTATTCTCACAATTTCCATAGTAATTGGTGT

TGGGGGTTGTTGGTTTGCTTATACACAAAATAAGACATCAAAGGAACATGTTGCAAAAATGATGAAAGACTTAGAGAGTCTGCAGACTGCAGAGCAGAGT

CTCATGGACTTACAAGAGAG ACTTGAAAAGGCACAGGAAGAAAACAGAACTGTTGCTGTAGAAAAGCAAAATCTGGAACGGAAAATGATGGATGAAATC

AACTATGCCAAGGAGGAGGCCTGTCGGCTGCGGGAGCTGAGGGAGGGCGCAGAGTGTGAGCTGAGCAGGCGCCAGTATGCAGAGCAGGAACTGGAGCAG 

GTCCGCATGGCTCTAAAAAAGGCCGAAAAGGAGTTTGAACTGAGAAGCAGCTGGTCTGTCCCTGACGCACTACAGAAATGGCTTCAGCTAACACACGAAG

TTGAAGTACAGTACTACAATATTAAGAGGCAAAATGCTGAGATGCAGCTAGCCATCGCTAAGGACGAG GCAGAAAAAATTAAAAAGAAGAGAAGCACAG

TCTTTGGGACCCTGCACGTTGCACACAGCTCCTCCCTGGACGAAGTAGACCACAAGATTCTGGAAGCCAA GAAAGCCCTCTCTGAGCTGACCACGTGCT

TGCGAGAACGGCTTTTTCGCTGGCAGCAGATTGAGAAGATCTGTGGCTTTCAGATAGCTCACAACTCTGGGCTCCCCAGTCTCACCTCCTCTCTGTACTC

TGACCACAGCTGGGTGGTGATGCCTAGAGTCTCCATTCCACCCTACCCTATTGCTGGAGGAGTTGATGACCTCGATGAAGACACACCCCCAATCGTGCCA

CAGTTTCCAG GGACCGTGGCTAAACCTGCAGGATCTTTAGCCAGAAGCAGTAGTTTATGCCGCTCTCGTCGCAGCATCGTGCCATCCTCCCCACAGTCT

CAGCGAGCTCAGCTTCCTGCTCATGCTCCTCTGGCAGCCCACCCTCGGCACCCTCACCATCCGCAGCATCCCCAGCACTCGTTGCCTTCCCCAGATCCAG

ACATCCTGTCTGTGTCAAGTTGCCCTGCTCTGTATCGGAACGAAGAGGAGGAGGAGGCTATCTACTTCACTGCTGAGAAACAATG GGAAGTGCCAGACA

CAGCTTCAGAATGTGACTCCTTAAACTCTTCCAGTGGGAGAAAACCGTCTCCCCCTTCAAGCCTTGAGATGTACCAAACATTGTCTTCCCGAAAAATCTC

AAGAGACGAGCTTTCCCTGGAGGACTCTTCCAGGGGGGAGTCACCCGTGACAGCAGATGTCTCCCGGGGCTCCCCTGAGTGTGTGGGTCTGACGGAGACC

AAGAGCATGATCTTCAGCCCTGCAAGCAGAGTGTACAATGGCATCCTGGAGAAATCCTGCAGCATGCACCAGCTCTCCAGCGGCATCCCGGTGCCTCATC

CCCGACACACATCGTGCTCCTCAGCCGGCAATGATAGCAAGCCAGTTCAGGAAGCCTCGAATGTTTCCAGAGTAAGCAGCATCCCACATGACCTCTGTCA

TAATGGTGAGAAAAGCAAAAAGCCATCCAAAATCAAAAGCCTTTTCAAGAAGAAGTCTAAGTGACTCGGCTGACGTGATGGAATTCCATTCAAGTGGCAT

CTGTAAACTGTTATCTCCCACCCTCCACTCCGTTTTTATTTTACTTTTAGGAATGTAACTCCACTGGGGCTTTCCAGACTTGATGCCATAGTGGAAATGT

CCGTAAGGGCAGCTGTCTACTGTCTGCTTATATCTAACTGACTACGCAATCAATTCATCAAGTCAGATACCACCACCGGAGCCATCGGCAGGAGGCAGTT

TACAGTTCTTTCCGCCTATTTATTTCTGCATTGATGTTAGTGATGTACACACAGCATTCTGTCGAAAGCCGCCATGGACTTACAAGCTTTAATGGACTGT

AAGCCAGCATGGGCTTGCAAAATTTTCTTGTTTACCAGAATATCTTCTTATCTTTCCACAGAGCTGTTTCCATCATGGACTAAATAACTTAAAAGAAGTA

AAACTGATTGCACTACTGTTTTCCAGACTGGAAAAAAAAATCTCTGCAAGTAAAACTGTATAGAGTTTATAAACTGACTGTGGATAGGGAATTGTTTTCA

CTTTTAGATAAAATGGATTTTTAAGTAGAAACTAGGGTTTCTAATTGACTTGATTTCTGAAAATGAAAACCCACACTTTTATTATGGGACGCTTCCTCAA

ATGCATTTATTATTATAAAGTTTCAAGTCCTGCTGTAAAGACCATGTTGTTTTGTTTTCCCCAGGGCTTTCACTGTGATTTACTGCACTGCAGGCTGTAT

GATAAAATATAAATAATGTAAAGGCAGAAGGCTCTTGATTCCTTATCCAAGTGGAAGAGTAAAACTTGATCGAAGGACTTAAAACATTCACATGCTTAAA

CTGCGGTCTGGGGCGTGGGGACCCAGGCACTTGTTTACAGACTTTGAATAAATGCAAAGAATTTATGGTTTGTGAAAAATTTGTACTGTGGAAAAGATAA

TAAATTGGAGACATTATTGTG
Translation
MLLFGLLVAGVADGCDLVPRHLRGRRASGSAGAAASPSAAAAGERQALLTD - UNI1310 - - UNI31491 - DPCMSLSPPCFTEEDRFSLEALQ

TIHKQMDDDKDGGIEVDESDE - UNI20575 - FIREDMKYKDATNKHSHLHREDKHITVEDLWKQWKTSEV - UNI33092 - VHNWTLEDTLQW

LIEFVELPQYEKNFRDNNVKGTTLPR RIAVHETSFMISQLKISDRSHRQKLQLKALDVVLFGPLTR RPPHNWMKDFILTISIVIGVGGCWFAYTQNKT

SKEHVAKMMKDLESLQTAEQSLMDLQER RLEKAQEENRTVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQ VRMALKKAEK

EFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDE AEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAK KKALSELTTCLRERLFRW

QQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVPQFPG GTVAKPAGSLARSSSLCRSRRSIVPSSPQSQRAQLP

AHAPLAAHPRHPHHPQHPQHSLPSPDPDILSVSSCPALYRNEEEEEAIYFTAEKQW WEVPDTASECDSLNSSSGRKPSPPSSLEMYQTLSSRKISRDEL

SLEDSSRGESPVTADVSRGSPECVGLTETKSMIFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEASNVSRVSSIPHDLCHNGEK

SKKPSKIKSLFKKKSK
Transcript ENSMUST00000117661
Sequence
CGCGGCGGCGGCGCGGGCGCTGGGCTGGGGCTTGGCCGCGCCAGAGCAGCGGATCCCGGTGTCGCCGCGGCAGCTGCGCGGGTGTCGCGCTGGGTCGGAA

GACGCCGTACCACTGCGCTCCCCCACTTTTTTTTTTTTTTTTTTTTTTAAATAACCGGAACCAATGAACGCGGCGGCGAGCCGAGCTTCGCGGGCCGCCG

GTGAAGGGAGCGGGTCAGCACCCGGCGGGAGTCCGCTTCCGAGGCGGCCGGGCCCCGGGCAGCTGGCGGTGAGCGAGTGGCCGGCGGCTCCTGTGAGCGC

TCCTCCCGCCGTGGCACCGGGCCGGGCCTCGGGCCGCCCTCTCCGGCGGCGCTGGGCAGCAATGCTGCTCTTCGGGTTGTTGGTGGCCGGCGTGGCGGAC

GGATGCGATCTGGTGCCCCGGCACCTCCGCGGGCGGCGCGCGTCGGGATCGGCCGGAGCGGCGGCGTCTCCTTCGGCTGCGGCTGCGGGCGAGCGCCAGG

CGCTGCTGACAG - UNI1310 - - UNI31491 - ATCCCTGTATGTCGCTGAGTCCACCTTGCTTCACTGAAGAAGACAGGTTTAGCTTGGAAGCA

CTTCAGACAATACACAAACAGATGGACGACGACAAGGACGGCGGGATCGAAGTGGACGAGAGTGATGAG - UNI20575 - TTTATCAGAGAAGATAT

GAAATATAAAGATGCTACGAATAAACATAGTCACCTGCACAGAGAAGATAAGCACATAACTGTTGAGGATTTGTGGAAACAGTGGAAAACATCAGAAG -

 UNI33092 - TTCACAATTGGACACTTGAGGATACCCTGCAGTGGTTAATAGAATTTGTTGAACTGCCACAATATGAGAAGAATTTTAGGGATAATAA

TGTGAAGGGAACAACACTCCCCAG GATAGCAGTTCATGAAACTTCATTTATGATTTCCCAGTTGAAAATCAGCGACCGAAGTCACAGACAGAAACTCCA

ACTCAAAGCCCTGGATGTGGTTCTGTTTGGGCCTCTGACAC GCCCACCTCATAACTGGATGAAGGATTTTATTCTCACAATTTCCATAGTAATTGGTGT

TGGGGGTTGTTGGTTTGCTTATACACAAAATAAGACATCAAAGGAACATGTTGCAAAAATGATGAAAGACTTAGAGAGTCTGCAGACTGCAGAGCAGAGT

CTCATGGACTTACAAGAGAG ACTTGAAAAGGCACAGGAAGAAAACAGAACTGTTGCTGTAGAAAAGCAAAATCTGGAACGGAAAATGATGGATGAAATC

AACTATGCCAAGGAGGAGGCCTGTCGGCTGCGGGAGCTGAGGGAGGGCGCAGAGTGTGAGCTGAGCAGGCGCCAGTATGCAGAGCAGGAACTGGAGCAG 

GTCCGCATGGCTCTAAAAAAGGCCGAAAAGGAGTTTGAACTGAGAAGCAGCTGGTCTGTCCCTGACGCACTACAGAAATGGCTTCAGCTAACACACGAAG

TTGAAGTACAGTACTACAATATTAAGAGGCAAAATGCTGAGATGCAGCTAGCCATCGCTAAGGACGAG GCAGAAAAAATTAAAAAGAAGAGAAGCACAG

TCTTTGGGACCCTGCACGTTGCACACAGCTCCTCCCTGGACGAAGTAGACCACAAGATTCTGGAAGCCAA GAAAGCCCTCTCTGAGCTGACCACGTGCT

TGCGAGAACGGCTTTTTCGCTGGCAGCAGATTGAGAAGATCTGTGGCTTTCAGATAGCTCACAACTCTGGGCTCCCCAGTCTCACCTCCTCTCTGTACTC

TGACCACAGCTGGGTGGTGATGCCTAGAGTCTCCATTCCACCCTACCCTATTGCTGGAGGAGTTGATGACCTCGATGAAGACACACCCCCAATCGTGCCA

CAGTTTCCAG GGACCGTGGCTAAACCTGCAGGATCTTTAGCCAGAAGCAGTAGTTTATGCCGCTCTCGTCGCAGCATCGTGCCATCCTCCCCACAGTCT

CAGCGAGCTCAGCTTCCTGCTCATGCTCCTCTGGCAGCCCACCCTCGGCACCCTCACCATCCGCAGCATCCCCAGCACTCGTTGCCTTCCCCAGATCCAG

ACATCCTGTCTGTGTCAAGTTGCCCTGCTCTGTATCGGAACGAAGAGGAGGAGGAGGCTATCTACTTCACTGCTGAGAAACAATG GGAAGTGCCAGACA

CAGCTTCAGAATGTGACTCCTTAAACTCTTCCAGTGGGAGAAAACCGTCTCCCCCTTCAAGCCTTGAGATGTACCAAACATTGTCTTCCCGAAAAATCTC

AAGAGACGAGCTTTCCCTGGAGGACTCTTCCAGGGGGGAGTCACCCGTGACAGCAGATGTCTCCCGGGGCTCCCCTGAGTGTGTGGGTCTGACGGAGACC

AAGAGCATGATCTTCAGCCCTGCAAGCAGAGTGTACAATGGCATCCTGGAGAAATCCTGCAGCATGCACCAGCTCTCCAGCGGCATCCCGGTGCCTCATC

CCCGACACACATCGTGCTCCTCAGCCGGCAATGATAGCAAGCCAGTTCAGGAAGCCTCGAATGTTTCCAGAGTAAGCAGCATCCCACATGACCTCTGTCA

TAATGGTGAGAAAAGCAAAAAGCCATCCAAAATCAAAAGCCTTTTCAAGAAGAAGTCTAAGTGACTCGGCTGACGTGATGGAATTCCATTCAAGTGGCAT

CTGTAAACTGTTATCTCCCACCCTCCACTCCGTTTTTATTTTACTTTTAGGAATGTAACTCCACTGGGGCTTTCCAGACTTGATGCCATAGTGGAAATGT

CCGTAAGGGCAGCTGTCTACTGTCTGCTTATATCTAACTGACTACGCAATCAATTCATCAAGTCAGATACCACCACCGGAGCCATCGGCAGGAGGCAGTT

TACAGTTCTTTCCGCCTATTTATTTCTGCATTGATGTTAGTGATGTACACACAGCATTCTGTCGAAAGCCGCCATGGACTTACAAGCTTTAATGGACTGT

AAGCCAGCATGGGCTTGCAAAATTTTCTTGTTTACCAGAATATCTTCTTATCTTTCCACAGAGCTGTTTCCATCATGGACTAAATAACTTAAAAGAAGTA

AAACTGATTGCACTACTGTTTTCCAGACTGGAAAAAAAAATCTCTGCAAGTAAAACTGTATAGAGTTTATAAACTGACTGTGGATAGGGAATTGTTTTCA

CTTTTAGATAAAATGGATTTTTAAGTAGAAACTAGGGTTTCTAATTGACTTGATTTCTGAAAATGAAAACCCACACTTTTATTATGGGACGCTTCCTCAA

ATGCATTTATTATTATAAAGTTTCAAGTCCTGCTGTAAAGACCATGTTGTTTTGTTTTCCCCAGGGCTTTCACTGTGATTTACTGCACTGCAGGCTGTAT

GATAAAATATAAATAATGTAAAGGCAGAAGGCTCTTGATTCCTTATCCAAGTGGAAGAGTAAAACTTGATCGAAGGACTTAAAACATTCACATGCTTAAA

CTGCGGTCTGGGGCGTGGGGACCCAGGCACTTGTTTACAGACTTTGAATAAATGCAAAGAATTTATGGTTTGTGAAAAATTTGTACTGTGGAAAAGATAA

TAAATTGGAGACATTATTGTGTGGGGTTGTGCTGATTTTTGTTGATAACACTCCACTGAAAACACTGTTTTCTGGAGAGCCATGTAAGCTGTCTTGCTGC

TGAATTGCAGTATAAGAAATAGCGATGTTTTGGAACTAAGTTGTCAACAAATTTCTTTGTTTTATATTGTTTGTCATATTTTTATGTAGTTTGAAATCTT

TAAATGTTCTCATATCAAGATTAACAAATATAAATTGCTGGTGCATTTAGATTGTGTTGAATGAGTTTGTAAAGTTTGGAACTGGTTAGCTGCTGGGCAG

GTCAGAGAGAAGCCTGAGAGTAGCCTCGCATAGGACAGCAGTGCACATTTCGTTTCCACCTTCTCAGCTCTTAAGACCTCAGGCAGAACTATCTGGAAAT

ACAGGAAGATGGGTGGTTGGGTGAACACGGATATGTTAACTAGAATTTTTTTTTGGTGCTGGCTATCTGGGAATGCTGATGGATAAGTAAGAAGTCCCCT

TGAGATTTGCATAAAAGGAGTGCTTTATTAAGGATCCAAATCTCAAAGCCTCCTGTGAGTTGTGATTATTTACTTCCATTGCTCTGGTTGTTATAATCGT

CAGGGTCTCACTGGGCTCGATGACTACCAATCAGCTCCTAAGATCAGAAGCTGACTGTCTGACATAAAGATGCTTTGCAAGATAGCGTGAAACATGGAGT

TCAGAGACCACTCTAGAGTTCTACTGGAAGGAAAGCAATTTTGCATAAAGAATTAGAAAGTGTCCAGGAAACCCCCCAGACTAAAGGGGATGTTTTGTCT

TTGTCACAGCTGGACCAGAGGCGTTCTCTTTGGGAATTGCAACAGAAATAAGCGCTTTTTAGTTTGATGGACAGAAAGGTCAAAGCTACCAGAGTGTGGA

GTGCATACAGAAGGCTTGGCTGCGAGATTGCTTATAGCTAGGGTTGGTAGGGCGTCCTGGGTCAGAGCCAGGTAGAAACTAGCGGAGGTTGGGCTGAGAG

AGTAGGGGTGGGTTTAGGAAAGGAGTGTATTGTGTATACCTGATTACACATTTATAAACAGGTCCAATGGAGGGATATGTACTGTTGTATGGTGTGATAT

TTATTTGCATTAGTAACAGTATTTGGAAAAGAACAGAAATCCAGAGGAAAGAAACTAGTTTTGGAAAGCCATCATCATTTTGGTATCACATCACATGCGA

AGCGTTGGGCATTTCTGTAAGTTTTACATATATTGCCTTCCTCTACTCTTTAAAAACTGATGCTCTCCTATTTCTCCCTAACTATAAGATGAGAAAGATT

CCTGGTAGTGAAGTGCAAAAAAGAAAACAGCAGCATGGCAGTCAAATCACGCTATTAAAATTACTTTTACTA
Translation
MNAAASRASRAAGEGSGSAPGGSPLPRRPGPGQLAVSEWPAAPVSAPPAVAPGRASGRPLRRRWAAMLLFGLLVAGVADGCDLVPRHLRGRRASGSAGAA

ASPSAAAAGERQALLTD - UNI1310 - - UNI31491 - DPCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVDESDE - UNI20575 -

 FIREDMKYKDATNKHSHLHREDKHITVEDLWKQWKTSEV - UNI33092 - VHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPR RIAVHET

SFMISQLKISDRSHRQKLQLKALDVVLFGPLTR RPPHNWMKDFILTISIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQER RLEKA

QEENRTVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQ VRMALKKAEKEFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQ

NAEMQLAIAKDE AEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAK KKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMP

RVSIPPYPIAGGVDDLDEDTPPIVPQFPG GTVAKPAGSLARSSSLCRSRRSIVPSSPQSQRAQLPAHAPLAAHPRHPHHPQHPQHSLPSPDPDILSVSS

CPALYRNEEEEEAIYFTAEKQW WEVPDTASECDSLNSSSGRKPSPPSSLEMYQTLSSRKISRDELSLEDSSRGESPVTADVSRGSPECVGLTETKSMIF

SPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEASNVSRVSSIPHDLCHNGEKSKKPSKIKSLFKKKSK
Transcript ENSMUST00000087347
Sequence
AGCGGATCCCGGTGTCGCCGCGGCAGCTGCGCGGGTGTCGCGCTGGGTCGGAAGACGCCGTACCACTGCGCTCCCCCACTTTTTTTTTTTTTTTTTTTTT

TAAATAACCGGAACCAATGAACGCGGCGGCGAGCCGAGCTTCGCGGGCCGCCGGTGAAGGGAGCGGGTCAGCACCCGGCGGGAGTCCGCTTCCGAGGCGG

CCGGGCCCCGGGCAGCTGGCGGTGAGCGAGTGGCCGGCGGCTCCTGTGAGCGCTCCTCCCGCCGTGGCACCGGGCCGGGCCTCGGGCCGCCCTCTCCGGC

GGCGCTGGGCAGCAATGCTGCTCTTCGGGTTGTTGGTGGCCGGCGTGGCGGACGGATGCGATCTGGTGCCCCGGCACCTCCGCGGGCGGCGCGCGTCGGG

ATCGGCCGGAGCGGCGGCGTCTCCTTCGGCTGCGGCTGCGGGCGAGCGCCAGGCGCTGCTGACAG - UNI1310 - - UNI31491 - ATCCCTGTA

TGTCGCTGAGTCCACCTTGCTTCACTGAAGAAGACAGGTTTAGCTTGGAAGCACTTCAGACAATACACAAACAGATGGACGACGACAAGGACGGCGGGAT

CGAAGTGGACGAGAGTGATGAG - UNI20575 - TTTATCAGAGAAGATATGAAATATAAAGATGCTACGAATAAACATAGTCACCTGCACAGAGAAG

ATAAGCACATAACTGTTGAGGATTTGTGGAAACAGTGGAAAACATCAGAAG - UNI33092 - TTCACAATTGGACACTTGAGGATACCCTGCAGTGG

TTAATAGAATTTGTTGAACTGCCACAATATGAGAAGAATTTTAGGGATAATAATGTGAAGGGAACAACACTCCCCAG GATAGCAGTTCATGAAACTTCA

TTTATGATTTCCCAGTTGAAAATCAGCGACCGAAGTCACAGACAGAAACTCCAACTCAAAGCCCTGGATGTGGTTCTGTTTGGGCCTCTGACAC GCCCA

CCTCATAACTGGATGAAGGATTTTATTCTCACAATTTCCATAGTAATTGGTGTTGGGGGTTGTTGGTTTGCTTATACACAAAATAAGACATCAAAGGAAC

ATGTTGCAAAAATGATGAAAGACTTAGAGAGTCTGCAGACTGCAGAGCAGAGTCTCATGGACTTACAAGAGAG ACTTGAAAAGGCACAGGAAGAAAACA

GAACTGTTGCTGTAGAAAAGCAAAATCTGGAACGGAAAATGATGGATGAAATCAACTATGCCAAGGAGGAGGCCTGTCGGCTGCGGGAGCTGAGGGAGGG

CGCAGAGTGTGAGCTGAGCAGGCGCCAGTATGCAGAGCAGGAACTGGAGCAG GTCCGCATGGCTCTAAAAAAGGCCGAAAAGGAGTTTGAACTGAGAAG

CAGCTGGTCTGTCCCTGACGCACTACAGAAATGGCTTCAGCTAACACACGAAGTTGAAGTACAGTACTACAATATTAAGAGGCAAAATGCTGAGATGCAG

CTAGCCATCGCTAAGGACGAG GTCGCTGCCTCCTATCTCCTGCAG GCAGAAAAAATTAAAAAGAAGAGAAGCACAGTCTTTGGGACCCTGCACGTTGC

ACACAGCTCCTCCCTGGACGAAGTAGACCACAAGATTCTGGAAGCCAA GAAAGCCCTCTCTGAGCTGACCACGTGCTTGCGAGAACGGCTTTTTCGCTG

GCAGCAGATTGAGAAGATCTGTGGCTTTCAGATAGCTCACAACTCTGGGCTCCCCAGTCTCACCTCCTCTCTGTACTCTGACCACAGCTGGGTGGTGATG

CCTAGAGTCTCCATTCCACCCTACCCTATTGCTGGAGGAGTTGATGACCTCGATGAAGACACACCCCCAATCGTGCCACAGTTTCCAG GGACCGTGGCT

AAACCTGCAGGATCTTTAGCCAGAAGCAGTAGTTTATGCCGCTCTCGTCGCAGCATCGTGCCATCCTCCCCACAGTCTCAGCGAGCTCAGCTTCCTGCTC

ATGCTCCTCTGGCAGCCCACCCTCGGCACCCTCACCATCCGCAGCATCCCCAGCACTCGTTGCCTTCCCCAGATCCAGACATCCTGTCTGTGTCAAGTTG

CCCTGCTCTGTATCGGAACGAAGAGGAGGAGGAGGCTATCTACTTCACTGCTGAGAAACAATG GGAAGTGCCAGACACAGCTTCAGAATGTGACTCCTT

AAACTCTTCCAGTGGGAGAAAACCGTCTCCCCCTTCAAGCCTTGAGATGTACCAAACATTGTCTTCCCGAAAAATCTCAAGAGACGAGCTTTCCCTGGAG

GACTCTTCCAGGGGGGAGTCACCCGTGACAGCAGATGTCTCCCGGGGCTCCCCTGAGTGTGTGGGTCTGACGGAGACCAAGAGCATGATCTTCAGCCCTG

CAAGCAGAGTGTACAATGGCATCCTGGAGAAATCCTGCAGCATGCACCAGCTCTCCAGCGGCATCCCGGTGCCTCATCCCCGACACACATCGTGCTCCTC

AGCCGGCAATGATAGCAAGCCAGTTCAGGAAGCCTCGAATGTTTCCAGAGTAAGCAGCATCCCACATGACCTCTGTCATAATGGTGAGAAAAGCAAAAAG

CCATCCAAAATCAAAAGCCTTTTCAAGAAGAAGTCTAAGTGACTCGGCTGACGTGATGGAATTCCATTCAAGTGGCATCTGTAAACTGTTATCTCCCACC

CTCCACTCCGTTTTTATTTTACTTTTAGGAATGTAACTCCACTGGGGCTTTCCAGACTTGATGCCATAGTGGAAATGTCCGTAAGGGCAGCTGTCTACTG

TCTGCTTATATCTAACTGACTACGCAATCAATTCATCAAGTCAGATACCACCACCGGAGCCATCGGCAGGAGGCAGTTTACAGTTCTTTCCGCCTATTTA

TTTCTGCATTGATGTTAGTGATGTACACACAGCATTCTGTCGAAAGCCGCCATGGACTTACAAGCTTTAATGGACTGTAAGCCAGCATGGGCTTGCAAAA

TTTTCTTGTTTACCAGAATATCTTCTTATCTTTCCACAGAGCTGTTTCCATCATGGACTAAATAACTTAAAAGAAGTAAAACTGATTGCACTACTGTTTT

CCAGACTGGAAAAAAAAATCTCTGCAAGTAAAACTGTATAGAGTTTATAAACTGACTGTGGATAGGGAATTGTTTTCACTTTTAGATAAAATGGATTTTT

AAGTAGAAACTAGGGTTTCTAATTGACTTGATTTCTGAAAATGAAAACCCACACTTTTATTATGGGACGCTTCCTCAAATGCATTTATTATTATAAAGTT

TCAAGTCCTGCTGTAAAGACCATGTTGTTTTGTTTTCCCCAGGGCTTTCACTGTGATTTACTGCACTGCAGGCTGTATGATAAAATATAAATAATGTAAA

GGCAGAAGGCTCTTGATTCCTTATCCAAGTGGAAGAGTAAAACTTGATCGAAGGACTTAAAACATTCACATGCTTAAACTGCGGTCTGGGGCGTGGGGAC

CCAGGCACTTGTTTACAGACTTTGAATAAATGCAAAGAATTTATGGTTTGTGAAAAATTTGTACTGTGGAAAAGATAATAAATTGGAGACATTATTGTGT

GGGGTTGTGCTGATTTTTGTTGATAACACTCCACTGAAAACACTGTTTTCTGGAGAGCCATGTAAGCTGTCTTGCTGCTGAATTGCAGTATAAGAAATAG

CGATGTTTTGGAACTAAGTTGTCAACAAATTTCTTTGTTTTATATTGTTTGTCATATTTTTATGTAGTTTGAAATCTTTAAATGTTCTCATATCAAGATT

AACAAATATAAATTGCTGGTGCATTTAGATTGTGTTGAATGAGTTTGTAAAGTTTGGAACTGGTTAGCTGCTGGGCAGGTCAGAGAGAAGCCTGAGAGTA

GCCTCGCATAGGACAGCAGTGCACATTTCGTTTCCACCTTCTCAGCTCTTAAGACCTCAGGCAGAACTATCTGGAAATACAGGAAGATGGGTGGTTGGGT

GAACACGGATATGTTAACTAGAATTTTTTTTTGGTGCTGGCTATCTGGGAATGCTGATGGATAAGTAAGAAGTCCCCTTGAGATTTGCATAAAAGG
Translation
MNAAASRASRAAGEGSGSAPGGSPLPRRPGPGQLAVSEWPAAPVSAPPAVAPGRASGRPLRRRWAAMLLFGLLVAGVADGCDLVPRHLRGRRASGSAGAA

ASPSAAAAGERQALLTD - UNI1310 - - UNI31491 - DPCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVDESDE - UNI20575 -

 FIREDMKYKDATNKHSHLHREDKHITVEDLWKQWKTSEV - UNI33092 - VHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPR RIAVHET

SFMISQLKISDRSHRQKLQLKALDVVLFGPLTR RPPHNWMKDFILTISIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQER RLEKA

QEENRTVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQ VRMALKKAEKEFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQ

NAEMQLAIAKDE VAASYLLQ AEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAK KKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLY

SDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVPQFPG GTVAKPAGSLARSSSLCRSRRSIVPSSPQSQRAQLPAHAPLAAHPRHPHHPQHPQHSLPSP

DPDILSVSSCPALYRNEEEEEAIYFTAEKQW WEVPDTASECDSLNSSSGRKPSPPSSLEMYQTLSSRKISRDELSLEDSSRGESPVTADVSRGSPECVG

LTETKSMIFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEASNVSRVSSIPHDLCHNGEKSKKPSKIKSLFKKKSK

For any suggestions or comments, please send an email to unitrap@crg.es