Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039191 (Rbpj)
Chromosomal location
Chr 5: 53947018 - 54048684 (+)
Description
recombination signal binding protein for immunoglobulin kappa J region Gene [Source:MGI Symbol;Acc:MGI:96522]
RefSeq_dna
NM_009035 
RefSeq_peptide
NP_033061.3 NP_001074397.1 
UniGene
Mm.409820 Mm.468225 Mm.209292 
MGI
MGI:96522 
Uniprot/SWISSPROT
P31266 
Uniprot/SPTREMBL
Q3U6F1 A0N920 
Human Ortholog
ENSG00000168214 (RBPSUH)
Omim not available
UniTrap UNI683
Vector Insertion
Chr 5: 53947143 - 53981453
Public Clones (sanger) AC0740 (sanger) DC0488 (sanger) XR0619 (sanger) DC0291 (sanger)
DC0094 (sanger) DC0738 (sanger) BB0587 (sanger) AD0211 (sanger)
RRD045 (baygenomics) RRR435 (baygenomics) XF503 (baygenomics) RRT231 (baygenomics)
RST345 (baygenomics) XN475 (baygenomics) RRE026 (baygenomics) RRS479 (baygenomics)
Ex178 (baygenomics) RRQ137 (baygenomics) P103C11 (ggtc) D008E08 (ggtc)
P118C03 (ggtc) P019B03 (ggtc) P066A01 (ggtc) P081F03 (ggtc) P010A06 (ggtc)
W062C06 (ggtc) 5SP141B07 (ggtc) 3SD046C08 (ggtc) 5SD039G09 (ggtc)
5SD028D10 (ggtc) 3SD018E10 (ggtc) 3SD002G09 (ggtc) 3SP096A03 (ggtc)
5SH008C09 (ggtc) H001C05 (ggtc) D039C08 (ggtc) D002D05 (ggtc) D041C06 (ggtc)
P105B05 (ggtc) P144C03 (ggtc) P109G11 (ggtc) P078A11 (ggtc) P055C04 (ggtc)
M075B02 (ggtc) D133H03 (ggtc) 5SP147C03 (ggtc) 5SP140A06 (ggtc) 5SD044H05 (ggtc)
5SD034A12 (ggtc) 5SD026H10 (ggtc) 5SD008E08 (ggtc) 3SP106E08 (ggtc)
5SP094B07 (ggtc) 5SH001C05 (ggtc) H008E01 (ggtc) D002G09 (ggtc)
P102E07 (ggtc) P151A08 (ggtc) D046C03 (ggtc) D018E10 (ggtc) P032B03 (ggtc)
P092G01 (ggtc) P079A01 (ggtc) Q016E02 (ggtc) M047E02 (ggtc) 3SP145H08 (ggtc)
3SD047H11 (ggtc) 5SD041C06 (ggtc) 5SD031B06 (ggtc) 3SD019C01 (ggtc)
3SD008A10 (ggtc) 3SP103C11 (ggtc) 3SH010B03 (ggtc) H003E10 (ggtc)
D031C04 (ggtc) P147C03 (ggtc) P148B06 (ggtc) P120F08 (ggtc) D015B05 (ggtc)
P140A06 (ggtc) P112E06 (ggtc) P064G04 (ggtc) P081G03 (ggtc) P008D08 (ggtc)
3SE285H02 (ggtc) 5SP140G05 (ggtc) 5SD046C03 (ggtc) 5SD039C08 (ggtc)
5SD027E09 (ggtc) 5SD015B05 (ggtc) 5SD002D05 (ggtc) 5SP095B08 (ggtc)
3SH008C09 (ggtc) P113A04 (ggtc) D047H11 (ggtc) D008A10 (ggtc) D045D09 (ggtc)
P107H11 (ggtc) P143A08 (ggtc) P109D08 (ggtc) P094B07 (ggtc) P112D04 (ggtc)
W195D05 (ggtc) D008F06 (ggtc) 3SP147C03 (ggtc) 5SP138H03 (ggtc) 3SD044H05 (ggtc)
3SD034A12 (ggtc) 5SD023D10 (ggtc) 3SD008E08 (ggtc) 3SP105B05 (ggtc)
3SM124A05 (ggtc) 5SD129G04 (ggtc) H008C09 (ggtc) P145H08 (ggtc)
P132D04 (ggtc) D026H10 (ggtc) D046C08 (ggtc) P141B07 (ggtc) P019G08 (ggtc)
P024F03 (ggtc) P095B08 (ggtc) Q021F08 (ggtc) M068B01 (ggtc) 5SP143A08 (ggtc)
5SD046C08 (ggtc) 3SD041C06 (ggtc) 5SD029A12 (ggtc) 5SD018E10 (ggtc)
5SD002G09 (ggtc) 5SP096B01 (ggtc) 3SH008E01 (ggtc) H003A04 (ggtc)
D036F05 (ggtc) D044H05 (ggtc) D030A11 (ggtc) D040B09 (ggtc) P106E08 (ggtc)
P119E07 (ggtc) P112B03 (ggtc) P063B03 (ggtc) P116F10 (ggtc) W240C01 (ggtc)
E063H02 (ggtc) 3SP148B06 (ggtc) 3SP140G05 (ggtc) 3SD045D09 (ggtc)
3SD039C08 (ggtc) 3SD027E09 (ggtc) 3SD015B05 (ggtc) 5SP106E08 (ggtc)
3SP095B08 (ggtc) 5SH004H05 (ggtc) P138H03 (ggtc) D023D10 (ggtc)
P130H01 (ggtc) D045E09 (ggtc) P134D09 (ggtc) Q997A07 (ggtc) M124A05 (ggtc)
P096A03 (ggtc) P110H12 (ggtc) M038B04 (ggtc) 5SP145H08 (ggtc) 3SE129G04 (ggtc)
3SD042B09 (ggtc) 5SD031C04 (ggtc) 3SD020E11 (ggtc) 5SD008A10 (ggtc)
5SP103C11 (ggtc) 5SH010B03 (ggtc) 5SD096E05 (ggtc) H007B12 (ggtc)
D034A12 (ggtc) D042E08 (ggtc) D027E09 (ggtc) PST19702-NR (escells) PST25083-NR (escells)
PST6939-NR (escells) PST17996-NR (escells) PST19398-NL (escells) PST16201-NR (escells)
Ayu21-T336 (egtc) IST10082G9 (tigm) IST12869G2 (tigm) IST15059F8 (tigm)
IST10046A10 (tigm) IST12419A5 (tigm) IST14547E4 (tigm) IST11532B11BBF1 (tigm)
IST11594D11 (tigm) IST14594B1 (tigm) IST14241H2 (tigm) IST13599F12 (tigm)
IST14116E1 (tigm) IST12942A4 (tigm) IST14917G12 (tigm) IST11532B11 (tigm)
IST14474D2 (tigm) IST12937A5 (tigm) IST10611E11 (tigm) IST11010F9 (tigm)
IST12846B8 (tigm) IST10072B10 (tigm) IST10522D12 (tigm) IST14171C11 (tigm)
IST14281B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4941
Vector Insertion
Chr 5: 53981726 - 53981812
Public Clones AQ0610 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15611
Vector Insertion
Chr 5: 53981964 - 54018621
Public Clones (sanger) D030A11 (ggtc) P118C03 (ggtc) D088G06 (ggtc) 3SH003A04 (ggtc)
P116F10 (ggtc) P136D08 (ggtc) D152B07 (ggtc) 5SD146E01 (ggtc) PST4349-NR (escells)
IST15000D12 (tigm) IST13619A6 (tigm) IST15056C8 (tigm) IST14700D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13892
Vector Insertion
Chr 5: 54018621 - 54018661
Public Clones CMHD-GT_209E4-3 (cmhd)
Private Clones OST451503 (lexicon) OST451136 (lexicon) OST365154 (lexicon) OST163104 (lexicon)
OST122023 (lexicon) OST121977 (lexicon) OST121918 (lexicon) OST119395 (lexicon)
OST65112 (lexicon) OST64331 (lexicon) OST63064 (lexicon) OST62539 (lexicon)
OST58592 (lexicon) OST54315 (lexicon) OST44187 (lexicon) OST43385 (lexicon)
OST42495 (lexicon) OST39674 (lexicon) OST38561 (lexicon) OST38325 (lexicon)
OST36166 (lexicon) OST36103 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2686
Vector Insertion
Chr 5: 54018661 - 54027200
Public Clones AK0653 (sanger) AL0448 (sanger) AS0126 (sanger) AK0709 (sanger)
RRI019 (baygenomics) P126E10 (ggtc) P128C04 (ggtc) P128H11 (ggtc)
P014D12 (ggtc) D006C09 (ggtc) D029E08 (ggtc) P128B10 (ggtc) W266E04 (ggtc)
D017F11 (ggtc) P130E09 (ggtc) CMHD-GT_346G7-3 (cmhd) CMHD-GT_311D02-3 (cmhd)
CMHD-GT_336E11-3 (cmhd) CMHD-GT_319C09-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30301
Vector Insertion
Chr 5: 54018661 - 54027200
Public Clones 5SP126E10 (ggtc) D017C02 (ggtc) D029E11 (ggtc) (ggtc) D006C09 (ggtc)
D029E08 (ggtc) IST14617A2 (tigm) IST14394H5 (tigm) IST14990D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8695
Vector Insertion
Chr 5: 54027200 - 54027297
Public Clones RRL018 (baygenomics) CMHD-GT_509E4-3 (cmhd)
Private Clones OST468292 (lexicon) OST466568 (lexicon) OST465046 (lexicon) OST464690 (lexicon)
OST461615 (lexicon) OST460176 (lexicon) OST459787 (lexicon) OST455910 (lexicon)
OST455578 (lexicon) OST455571 (lexicon) OST451953 (lexicon) OST448731 (lexicon)
OST439397 (lexicon) OST435517 (lexicon) OST430222 (lexicon) OST425817 (lexicon)
OST420627 (lexicon) OST411053 (lexicon) OST404023 (lexicon) OST393505 (lexicon)
OST385986 (lexicon) OST377694 (lexicon) OST374442 (lexicon) OST370186 (lexicon)
OST361677 (lexicon) OST360694 (lexicon) OST359483 (lexicon) OST359410 (lexicon)
OST359409 (lexicon) OST359317 (lexicon) OST359008 (lexicon) OST356843 (lexicon)
OST351558 (lexicon) OST351372 (lexicon) OST349563 (lexicon) OST349388 (lexicon)
OST341640 (lexicon) OST340136 (lexicon) OST340103 (lexicon) OST336883 (lexicon)
OST334733 (lexicon) OST328655 (lexicon) OST314055 (lexicon) OST306535 (lexicon)
OST299966 (lexicon) OST297329 (lexicon) OST294339 (lexicon) OST293671 (lexicon)
OST289042 (lexicon) OST285330 (lexicon) OST242533 (lexicon) OST240778 (lexicon)
OST235081 (lexicon) OST215557 (lexicon) OST215180 (lexicon) OST213651 (lexicon)
OST209385 (lexicon) OST206936 (lexicon) OST205550 (lexicon) OST205287 (lexicon)
OST205157 (lexicon) OST199673 (lexicon) OST194362 (lexicon) OST191954 (lexicon)
OST191762 (lexicon) OST187051 (lexicon) OST172564 (lexicon) OST131514 (lexicon)
OST131461 (lexicon) OST131286 (lexicon) OST130670 (lexicon) OST127934 (lexicon)
OST127189 (lexicon) OST126676 (lexicon) OST124438 (lexicon) OST124437 (lexicon)
OST116326 (lexicon) OST114000 (lexicon) OST110971 (lexicon) OST104983 (lexicon)
OST102633 (lexicon) OST101486 (lexicon) OST95866 (lexicon) OST92185 (lexicon)
OST85811 (lexicon) OST79614 (lexicon) OST63316 (lexicon) OST63147 (lexicon)
OST62737 (lexicon) OST62210 (lexicon) OST61525 (lexicon) OST60853 (lexicon)
OST60320 (lexicon) OST59342 (lexicon) OST59323 (lexicon) OST57786 (lexicon)
OST57638 (lexicon) OST54834 (lexicon) OST54597 (lexicon) OST53198 (lexicon)
OST51950 (lexicon) OST51110 (lexicon) OST50548 (lexicon) OST49168 (lexicon)
OST47137 (lexicon) OST46389 (lexicon) OST46291 (lexicon) OST41379 (lexicon)
OST39609 (lexicon) OST36175 (lexicon) OST35530 (lexicon) OST31021 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15317
Vector Insertion
Chr 5: 54027297 - 54033262
Public Clones PST6176-NR (escells) IST11189H5 (tigm) IST11261C6 (tigm)
Private Clones OST447769 (lexicon) OST443149 (lexicon) OST440102 (lexicon) OST411968 (lexicon)
OST407639 (lexicon) OST386330 (lexicon) OST374838 (lexicon) OST368709 (lexicon)
OST333422 (lexicon) OST315417 (lexicon) OST305256 (lexicon) OST261874 (lexicon)
OST243043 (lexicon) OST227196 (lexicon) OST225582 (lexicon) OST211837 (lexicon)
OST196021 (lexicon) OST195975 (lexicon) OST187495 (lexicon) OST186689 (lexicon)
OST186638 (lexicon) OST129298 (lexicon) OST118754 (lexicon) OST111674 (lexicon)
OST95402 (lexicon) OST75641 (lexicon) OST61670 (lexicon) OST54938 (lexicon)
OST54281 (lexicon) OST48965 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35352
Vector Insertion
Chr 5: 54033429 - 54037108
Public Clones IST14724H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5126
Vector Insertion
Chr 5: 54037284 - 54040609
Public Clones YTC293 (baygenomics) F15048 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4160
Vector Insertion
Chr 5: 54040748 - 54040901
Public Clones AM0799 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23407
Vector Insertion
Chr 5: 54041015 - 54042578
Public Clones not available
Private Clones OST260845 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31501
Vector Insertion
Chr 5: 54042720 - 54043845
Public Clones CMHD-GT_540H10-5S (cmhd) IST14132A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113865
Sequence
CGGGGAAAGACGGCGCGGGGGCCGGGTGGCAGCGATCGGCGAGGCCGAGGGAAGGGGCGGGGGAGAGGAGCAGGGAAAGGCGGCGGGGGGAATCTCGCGA

GGGTTGGAGTTTTGGCGAGAGTTTGTGGAAGATGGCGCCTGTTGTGACAGG - UNI13892 - - UNI15611 - GAAGTTTGGTGAGCGGCCTCCA

CCCAAACGACTCACTAG - UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 - GGAAGCTATGCGAAATTATTTAAAAGAACGAG

GGGATCAAACAGTGCTCATTCTTCATGCAAAAGTTGCACAGAAGTCTTACGGAAATGAAAAACG - UNI8695 - - UNI15317 - ATTTTTTTGC

CCTCCTCCTTGTGTGTATCTTATGGGCAGTGGTTGGAAGAAAAAAAAAGAGCAAATGGAACGAGATGGATGTTCTGAACAAGAGTCTCAACCCTGTGCGT

TTATTGGAATAGGAAACAGTGACCAAGAAATGCAGCAGCTGAACTTGGAAGGGAAG - UNI35352 - AACTACTGTACAGCCAAAACATTGTACATA

TCTGATTCAGACAAGAGAAAACATTTCATGTTGTCTGTAAAGATGTTCTATGGCAACAGCGATGACATTGGTGTGTTCCTCAGCAAGCGGATAAAGGTCA

TCTCCAAACCCTCCAAAAAGAAGCAGTCACTGAAGAATGCTGACT - UNI5126 - TGTGCATTGCTTCAGGAACGAAGGTGGCACTGTTCAATCGCC

TTCGGTCCCAGACAGTTAGTACCAGGTACCTGCATGTAGAAGGAGGGAATTTCCACGCCAGTTCACAACAGTGGGGAGCATTTTACATCCATCTCT - U

NI4160 - TGGACGACGACGAGTCGGAAGGAGAGGAGTTCACAGTTAGAGATGGCTACATCCATTACGGGCAGACTGTCAAGCTTGTGTGCTCAGTGAC

TGGCATGGCACTCCCAAGATTG - UNI23407 - ATAATTAGGAAAGTTGATAAGCAGACGGCATTACTGGATGCAGACGACCCTGTATCACAACTCC

ACAAATGTGCATTTTACCTTAAGGATACAGAAAGAATGTACTTGTGCCTTTCTCAAGAAAGAATAATCCAATTTCAG - UNI31501 - GCCACTCCA

TGTCCAAAAGAACAAAATAAGGAAATGATAAACGATGGAGCTTCCTGGACAATCATTAGCACAGACAAGGCCGAGTACACGTTCTATGAGGGAATGGGCC

CCGTCCTTGCCCCAGTCACCCCTGTGCCTGTCGTAGAAAGTCTTCAG TTGAATGGCGGCGGGGACGTAGCAATGCTTGAACTTACAGGACAAAACTTTA

CTCCAAATTTAAGAGTGTGGTTTGGGGATGTAGAAGCCGAAACAATGTACAG ATGTGGAGAGAGCATGCTCTGTGTGGTCCCAGACATTTCTGCATTCC

GGGAAGGTTGGAGATGGGTCCGCCAGCCAGTCCAGGTTCCAGTGACTTTGGTCCGAAATGACGGGGTCATTTACTCCACCAGCCTTACCTTCACCTACAC

ACCAGAGCCAGGGCCGAGGCCACACTGCAGCGCTGCAGGAGCGATTCTCAGAGCCAACTCCAGCCAAGTGCCCTCCAATGAGTCAAACACAAACAGCGAG

GGGAATTACACAAATGCCAGCACAAATTCTACCAGTGTCACATCGTCCACAGCAACCGTGGTGTCCTAACTACCGTCTTTTTGCTGGGACTGAAACTGAC

TTGAATGCAGCAAAAAGTTGACAGAGAAAGGCAAGGATAAAGTGAACAATCTTTTGTGGTTTCTTGGGGAAACGTTTCGTACCAGGTGATCTATTCAAAA

CTGCCAGTGCAGGTGTGACATGCAGAGGCCACAGTACAATGAACAACATCAGAATGCACAGGCTGATGGAAATCCAGGTTTTCAGCTGTCCCTCTCACAC

GCACCCCTTTTTGGTTGTTTTGGTTTGGTTTTGATTTAATGGCCAGGAAACAGATATGTGGCTGGAGCACAGGCTAAGCTAGAAGACACAAACCTAACAT

AGACTTATGGACCAAGGGACTCGCATAAGCTTTAGTGAAAGGTACATTTTCACCATGCCTTTTTTATATCACAGTGTGTACTACACCTTGTTACCAAACA

GGTTGCGCTCCCCACCCTTTGAGGGTTGGCTCTAAAGTACATTCATTCAGGTTCGAGCCTCACCATGTTTGTTCAGTCTGAACACTGAACACTTCCAGGT

TCTTGTGGTCTAAGGCTGGAACTTTTTTAAGCTGAAGTCTTATGACTTTTTCATAAGTTGGAATTATTTTGATTTCAGCAAGTCAAATTTTGTAAAGGCC

TGCATATTTTTTTTAAGATTATATGAAGTCTGCAAAAGCTTTAAAAATGCCTCTGCCTTGCCTGCAATACATGCAATGTGTGTTAACTGAGTCTGTTCTC

AGAATCTGTTGGTAGTTATTTCTGTGTTTTCCCTTTTTTTAAAGAAATGTATTTATAGTGGTAATCTAAGAGATGCTAACAGCTCCGTGTGGCCATTTAG

CCCTTTCTGAGTTCATGGCAGTGAGCACTGCCGTTCGAAGGCTGTGCGCCTCTGCCTGTTCATCAGTTCATCTGTGTTCCAGGATTTGTTCAGGTTTCCC

CTTCCCCCAAATCTTGTACATAACTTGTATTATGTGTAAGTTAAACATTTTATCTTTACTTGGAATGTTCCCAGTGATTACATTTCACAGGGTGTTTCCC

ACCTTGTTGGCAAATGACAAAAAATATCATGCGAATTATTTGCTACCAAGATGGTGCCCGTAGGGTAAAATGAGGAACATCTCTGCAGGATGATTTATTG

TATGTTTTCCTTTTTTTTTAGCCTAGCCAGAACATCATTATAATTTTAAAGACCATAAGATGGCTTTTATTAGATGATAACTAAATAAACTGAACTAAGT

AGCCAGAAGACAGTACCTTAGAGACTGATAGTTGTAAGTTTATAAAAATACAAATGTAACTTATATTTCCATTTTCCTCTTTGCCCCTTTGTTTATTTTC

CCCAGTAGAAATGTTCTGTCCAGATTTTTTTCCCCCTTTTTAGTTAAGCCTTGCTTGCATTCAGGCTTGTGTGTCAGCCCTGTGTGCCAATATGCCAGAT

TCATTTTGTTTCCATCCCTGCACTTTGGTTATTCCTTGTTCAGTTTCTTGGGAATTGAAGCAGACTCATTGGGCTACATTTAGTACAAGAACCACATGTG

TGATGTTAAAGGACACAGTCTAGTGATGCCATCATCCTTGAGTAAAAACTACCTCTAGATTGTGGTAAGCTTTTACTGTCCCTTAAAACAGGAGCCACTA

GTACCTTATGAATGCAGACTGTAACTTCTATGGCATTTTCTGGTGTCTTTCTGGCTCTCTGGGCTTCTGAAAGTTTTCACGTAGACCCTTAGACTCCTCT

GTCAGGACCATTGCTTTCCAGCGTTGCTGCTTTCACTCGCTGTCTCGAAGACTGTACCACTGTAAGTGCCACTGCGAACATCTTTAAACGGCTCCTCCTT

GGCTTGTCAAGGGGAAGGCCACCTGTAAGATGTGGTGGTGACAGCCTTCCTGTCCACCCCAGGCTGCTCCTTACCAGCTGTTCTAGCCGATTCTCTTCAG

ATCAGCTACAGCCCACCTCCTCCCCGCCCCGCCTCACCCCTCCAGGCTGTCTCAGTGGTCCAGGGCAGAGCTCACTGTGGCCTTACTGATCTATCTCTGC

AGTAACTGTTCTCCCTCAGTTGCGATGGAAGCAGGCCCCTGCGATCTGTTCAGAGCCTGAGCAGTTTGCAGTTCCGTTGTGCTTTCTGAGGTCCTAGATT

CAGGATGTAGTTAAGTCGATAACTGAGAACAGATGAGATGCTTTTAAAGAACAAACTCTTCCTTACCCAGCTTTGTAGCTTAAAGTAAGTTTTCAAGTTC

ATGGCTTTATTAAAATGAACTTTGACTTTTTAAAATGCTTATATCTCATTTCGGTTCTTTTGTTTATTTTAGTAAGAATTGAAACAGACTATAAGTAGTT

TTCCTGTTTGTTTGTTTGTTTGTTTGTTTTTTACAAAGTTCAAGAATGTAACAATAAAGGCATTTTGCTATGGTTCTATGTCAGACTCCTACCACAGAAT

AGTGTGAACAGATATGTCTGTCTGCTTTACCATGTTATTGATAGTTCTTTTGTCAGCTGCTTTTATTAAAAGTCCTCTTTTGTGAATTTGTAAATCAATT

TCAATATATGATGTACAGGAGTCTTGTCCCCCGTTACTGTGGAATGTTCCCCCCTGTTGATGCTGGTCCCTTTATCCTCTTATCTTCTTAGAACCGGGAA

TTCTTCAGTTGTGGTGTGTGGCTGTATTTTTCTATTCTGTTTACAGTGCGTCTACACAGCTTCTTAAAACATGTCGAAATGCAGAATCCAAGATCCACCA

TGAATTTGTCAAGAGATTGGAAGGCAGGCCAAAACCTGAAAATGTGGGGTGCCCTTTGTACAATTGCAGAGTCAAGCACTAGTGGGAGTTTGAACTGGCT

ACTGACCGCTCTTAAACTGTGGCAGTGTCCTTGGGTACAGTTAACTAGCAGAACCTGCTGTCACTCTTCCTGCCACCATCTTAACCTTGACAGTTTTGTT

TCTTTTCTGTGTGGTGCTGGGGTCAAATCCAGAGCCTTAGGCTTGCTAAGGCTTTTTGTTTGTTTGATTTTTCCTTGAGACAAGTGTCTCACCCATGGAG

CCCCTCAGCATTCTTGAAAGTCTCTGCCTTAGCCTCCAGGTCCTGTGGTACCAGGTGTGGCAGGATGCTTTTGTCATTAGAGAAACTGGTCTGTGTCCAA

CCACAGAAAAATTCCAATGCAGTTTTTAATAATTAATCCACTAGTTATTTAATCAAAATCTTTTTGTAGGGAGAGATTCCTGTTTGAAAGAAAATGCTAT

TTGATTATTAACCAAGGTAACAGACACTGCTTTCCAAAGCAGCTGTGTTTCTGGTGAGTACTGAACAAATGTGTGGTTTTCTGTGCCACCTTTGATTCAT

TTTTCAAGCACTGTTACTCGGGATGGATGGTTAGAAACATGATATTTTAGTGTTTCTACTTAACCCTTTCAGGACCGAGCTGTATTGCCTTTCTATTAAT

TTCCCCCTGTGTTGTGATAAATGTTTGCTCGTGTTCAGTCCTGTGTCAGTCCAGACGTAGGTTTGTGTAAAAGCTCAGTTGTAGCTTATTTCTTGTACCT

TGCAGCATGTTCTACGCATCCAGTCCTTAAGGGGTTTACTCTACAAACTGTGCACCTGCGTGTAAGGGTCATTAGCAATAAGATAGAAAATTGAGCAAGT

TTATACCATAATTTTGTAGAAAAAGGAATCTGCTCAATTCCATATTTCATCCATGAAAACTCTGCAATACGGGCAGTTTCTAGGAATAAATAAAAAGGAG

ATGCAAACCATTGTAGATGTCTTCTGTGGGATGTGCCCGATGCGTGCATCATCGTCTTTGATTCCAGGTACTTCATAAAGATAAAATTAAATTC
Translation
 - UNI13892 - - UNI15611 -  - UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 - MRNYLKERGDQTVLILHAKVAQ

KSYGNEKR - UNI8695 - - UNI15317 - RFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK - UNI3535

2 - NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADL - UNI5126 - LCIASGTKVALFNRLRSQTVSTRY

LHVEGGNFHASSQQWGAFYIHLL - UNI4160 - LDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL - UNI23407 - IIRKVDKQTALL

DADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQ - UNI31501 - ATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL

Q LNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYR RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAA

GAILRANSSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS
Transcript ENSMUST00000037618
Sequence
GGGAAGCCACTTGGAAAACACCCACTCGAGGAGGCGTCTCCTCTAGGCCTGTGAGACGCTCGCATTTTCCCAGGACCCCTCCTCCCGGCCCCGGGGCCCC

GCCTCCTGACCCCTCCAGTCCCGGTCCCCGTAGTAATGCCCTCCGGTTTTCCTCAGTCTCCACGTACGTCCCCGAGGGCGCGTCCCAAAACCCGGATAAC

CGGAGCGCTCCCCATGGACTACTCGGAGGGCTTGTCCGCGGAGGAGCGGCCTGCGCATGCTCCATCGGCGGG - UNI4941 - - UNI13892 - - 

UNI15611 - GAAGTTTGGTGAGCGGCCTCCACCCAAACGACTCACTAG - UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 -

 GGAAGCTATGCGAAATTATTTAAAAGAACGAGGGGATCAAACAGTGCTCATTCTTCATGCAAAAGTTGCACAGAAGTCTTACGGAAATGAAAAACG - 

UNI8695 - - UNI15317 - ATTTTTTTGCCCTCCTCCTTGTGTGTATCTTATGGGCAGTGGTTGGAAGAAAAAAAAAGAGCAAATGGAACGAGATG

GATGTTCTGAACAAGAGTCTCAACCCTGTGCGTTTATTGGAATAGGAAACAGTGACCAAGAAATGCAGCAGCTGAACTTGGAAGGGAAG - UNI35352

 - AACTACTGTACAGCCAAAACATTGTACATATCTGATTCAGACAAGAGAAAACATTTCATGTTGTCTGTAAAGATGTTCTATGGCAACAGCGATGACA

TTGGTGTGTTCCTCAGCAAGCGGATAAAGGTCATCTCCAAACCCTCCAAAAAGAAGCAGTCACTGAAGAATGCTGACT - UNI5126 - TGTGCATTG

CTTCAGGAACGAAGGTGGCACTGTTCAATCGCCTTCGGTCCCAGACAGTTAGTACCAGGTACCTGCATGTAGAAGGAGGGAATTTCCACGCCAGTTCACA

ACAGTGGGGAGCATTTTACATCCATCTCT - UNI4160 - TGGACGACGACGAGTCGGAAGGAGAGGAGTTCACAGTTAGAGATGGCTACATCCATTA

CGGGCAGACTGTCAAGCTTGTGTGCTCAGTGACTGGCATGGCACTCCCAAGATTG - UNI23407 - ATAATTAGGAAAGTTGATAAGCAGACGGCAT

TACTGGATGCAGACGACCCTGTATCACAACTCCACAAATGTGCATTTTACCTTAAGGATACAGAAAGAATGTACTTGTGCCTTTCTCAAGAAAGAATAAT

CCAATTTCAG - UNI31501 - GCCACTCCATGTCCAAAAGAACAAAATAAGGAAATGATAAACGATGGAGCTTCCTGGACAATCATTAGCACAGACA

AGGCCGAGTACACGTTCTATGAGGGAATGGGCCCCGTCCTTGCCCCAGTCACCCCTGTGCCTGTCGTAGAAAGTCTTCAG TTGAATGGCGGCGGGGACG

TAGCAATGCTTGAACTTACAGGACAAAACTTTACTCCAAATTTAAGAGTGTGGTTTGGGGATGTAGAAGCCGAAACAATGTACAG ATGTGGAGAGAGCA

TGCTCTGTGTGGTCCCAGACATTTCTGCATTCCGGGAAGGTTGGAGATGGGTCCGCCAGCCAGTCCAGGTTCCAGTGACTTTGGTCCGAAATGACGGGGT

CATTTACTCCACCAGCCTTACCTTCACCTACACACCAGAGCCAGGGCCGAGGCCACACTGCAGCGCTGCAGGAGCGATTCTCAGAGCCAACTCCAGCCAA

GTGCCCTCCAATGAGTCAAACACAAACAGCGAGGGGAATTACACAAATGCCAGCACAAATTCTACCAGTGTCACATCGTCCACAGCAACCGTGGTGTCCT

AACTACCGTCTTTTTGCTGGGACTGAAACTGACTTGAATGCAGCAAAAAGTTGACAGAGAAAGGCAAGGATAAAGTGAACAATCTTTTGTGGTTTCTTGG

GGAAACGTTTCGTACCAGGTGATCTATTCAAAACTGCCAGTGCAGGTGTGACATGCAGAGGCCACAGTACAATGAACAACATCAGAATGCACAGGCTGAT

GGAAATCCAGGTTTTCAGCTGTCCCTCTCACACGCACCCCTTTTTGGTTGTTTTGGTTTGGTTTTGATTTAATGGCCAGGAAACAGATATGTGGCTGGAG

CACAGGCTAAGCTAGAAGACACAAACCTAACATAGACTTATGGACCAAGGGACTCGCATAAGCTTTAGTGAAAGGTACATTTTCACCATGCCTTTTTTAT

ATCACAGTGTGTACTACACCTTGTTACCAAACAGGTTGCGCTCCCCACCCTTTGAGGGTTGGCTCTAAAGTACATTCATTCAGGTTCGAGCCTCACCATG

TTTGTTCAGTCTGAACACTGAACACTTCCAGGTTCTTGTGGTCTAAGGCTGGAACTTTTTTAAGCTGAAGTCTTATGACTTTTTCATAAGTTGGAATTAT

TTTGATTTCAGCAAGTCAAATTTTGTAAAGGCCTGCATATTTTTTTTAAGATTATATGAAGTCTGCAAAAGCTTTAAAAATGCCTCTGCCTTGCCTGCAA

TACATGCAATGTGTGTTAACTGAGTCTGTTCTCAGAATCTGTTGGTAGTTATTTCTGTGTTTTCCCTTTTTTTAAAGAAATGTATTTATAGTGGTAATCT

AAGAGATGCTAACAGCTCCGTGTGGCCATTTAGCCCTTTCTGAGTTCATGGCAGTGAGCACTGCCGTTCGAAGGCTGTGCGCCTCTGCCTGTTCATCAGT

TCATCTGTGTTCCAGGATTTGTTCAGGTTTCCCCTTCCCCCAAATCTTGTACATAACTTGTATTATGTGTAAGTTAAACATTTTATCTTTACTTGGAATG

TTCCCAGTGATTACATTTCACAGGGTGTTTCCCACCTTGTTGGCAAATGACAAAAAATATCATGCGAATTATTTGCTACCAAGATGGTGCCCGTAGGGTA

AAATGAGGAACATCTCTGCAGGATGATTTATTGTATGTTTTCCTTTTTTTTTAGCCTAGCCAGAACATCATTATAATTTTAAAGACCATAAGATGGCTTT

TATTAGATGATAACTAAATAAACTGAACTAAGTAGCCAGAAGACAGTACCTTAGAGACTGATAGTTGTAAGTTTATAAAAATACAAATGTAACTTATATT

TCCATTTTCCTCTTTGCCCCTTTGTTTATTTTCCCCAGTAGAAATGTTCTGTCCAGATTTTTTTCCCCCTTTTTAGTTAAGCCTTGCTTGCATTCAGGCT

TGTGTGTCAGCCCTGTGTGCCAATATGCCAGATTCATTTTGTTTCCATCCCTGCACTTTGGTTATTCCTTGTTCAGTTTCTTGGGAATTGAAGCAGACTC

ATTGGGCTACATTTAGTACAAGAACCACATGTGTGATGTTAAAGGACACAGTCTAGTGATGCCATCATCCTTGAGTAAAAACTACCTCTAGATTGTGGTA

AGCTTTTACTGTCCCTTAAAACAGGAGCCACTAGTACCTTATGAATGCAGACTGTAACTTCTATGGCATTTTCTGGTGTCTTTCTGGCTCTCTGGGCTTC

TGAAAGTTTTCACGTAGACCCTTAGACTCCTCTGTCAGGACCATTGCTTTCCAGCGTTGCTGCTTTCACTCGCTGTCTCGAAGACTGTACCACTGTAAGT

GCCACTGCGAACATCTTTAAACGGCTCCTCCTTGGCTTGTCAAGGGGAAGGCCACCTGTAAGATGTGGTGGTGACAGCCTTCCTGTCCACCCCAGGCTGC

TCCTTACCAGCTGTTCTAGCCGATTCTCTTCAGATCAGCTACAGCCCACCTCCTCCCCGCCCCGCCTCACCCCTCCAGGCTGTCTCAGTGGTCCAGGGCA

GAGCTCACTGTGGCCTTACTGATCTATCTCTGCAGTAACTGTTCTCCCTCAGTTGCGATGGAAGCAGGCCCCTGCGATCTGTTCAGAGCCTGAGCAGTTT

GCAGTTCCGTTGTGCTTTCTGAGGTCCTAGATTCAGGATGTAGTTAAGTCGATAACTGAGAACAGATGAGATGCTTTTAAAGAACAAACTCTTCCTTACC

CAGCTTTGTAGCTTAAAGTAAGTTTTCAAGTTCATGGCTTTATTAAAATGAACTTTGACTTTTTAAAATGCTTATATCTCATTTCGGTTCTTTTGTTTAT

TTTAGTAAGAATTGAAACAGACTATAAGTAGTTTTCCTGTTTGTTTGTTTGTTTGTTTGTTTTTTACAAAGTTCAAGAATGTAACAATAAAGGCATTTTG

CTATGGTTCTATGTCAGACTCCTACCACAGAATAGTGTGAACAGATATGTCTGTCTGCTTTACCATGTTATTGATAGTTCTTTTGTCAGCTGCTTTTATT

AAAAGTCCTCTTTTGTGAATTTGTAAATCAATTTCAATATATGATGTACAGGAGTCTTGTCCCCCGTTACTGTGGAATGTTCCCCCCTGTTGATGCTGGT

CCCTTTATCCTCTTATCTTCTTAGAACCGGGAATTCTTCAGTTGTGGTGTGTGGCTGTATTTTTCTATTCTGTTTACAGTGCGTCTACACAGCTTCTTAA

AACATGTCGAAATGCAGAATCCAAGATCCACCATGAATTTGTCAAGAGATTGGAAGGCAGGCCAAAACCTGAAAATGTGGGGTGCCCTTTGTACAATTGC

AGAGTCAAGCACTAGTGGGAGTTTGAACTGGCTACTGACCGCTCTTAAACTGTGGCAGTGTCCTTGGGTACAGTTAACTAGCAGAACCTGCTGTCACTCT

TCCTGCCACCATCTTAACCTTGACAGTTTTGTTTCTTTTCTGTGTGGTGCTGGGGTCAAATCCAGAGCCTTAGGCTTGCTAAGGCTTTTTGTTTGTTTGA

TTTTTCCTTGAGACAAGTGTCTCACCCATGGAGCCCCTCAGCATTCTTGAAAGTCTCTGCCTTAGCCTCCAGGTCCTGTGGTACCAGGTGTGGCAGGATG

CTTTTGTCATTAGAGAAACTGGTCTGTGTCCAACCACAGAAAAATTCCAATGCAGTTTTTAATAATTAATCCACTAGTTATTTAATCAAAATCTTTTTGT

AGGGAGAGATTCCTGTTTGAAAGAAAATGCTATTTGATTATTAACCAAGGTAACAGACACTGCTTTCCAAAGCAGCTGTGTTTCTGGTGAGTACTGAACA

AATGTGTGGTTTTCTGTGCCACCTTTGATTCATTTTTCAAGCACTGTTACTCGGGATGGATGGTTAGAAACATGATATTTTAGTGTTTCTACTTAACCCT

TTCAGGACCGAGCTGTATTGCCTTTCTATTAATTTCCCCCTGTGTTGTGATAAATGTTTGCTCGTGTTCAGTCCTGTGTCAGTCCAGACGTAGGTTTGTG

TAAAAGCTCAGTTGTAGCTTATTTCTTGTACCTTGCAGCATGTTCTACGCATCCAGTCCTTAAGGGGTTTACTCTACAAACTGTGCACCTGCGTGTAAGG

GTCATTAGCAATAAGATAGAAAATTGAGCAAGTTTATACCATAATTTTGTAGAAAAAGGAATCTGCTCAATTCCATATTTCATCCATGAAAACTCTGCAA

TACGGGCAGTTTCTAGGAATAAATAAAAAGGAGATGCAAACCATTGTAGATGTCTTCTGTGGGATGTGCCCGATGCGTGCATCATCGTCTTTGATTCCAG

GTACTTCATAAAGATAAAATTAAATTC
Translation
MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAG - UNI4941 - - UNI13892 - - UNI15611 - GKFGERPPPKRLTR 

- UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 - REAMRNYLKERGDQTVLILHAKVAQKSYGNEKR - UNI8695 - - UN

I15317 - RFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK - UNI35352 - NYCTAKTLYISDSDKRKHFML

SVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADL - UNI5126 - LCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLL -

 UNI4160 - LDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL - UNI23407 - IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLC

LSQERIIQFQ - UNI31501 - ATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQ LNGGGDVAMLELTGQNFTPNLRV

WFGDVEAETMYR RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPSNESNTNSEGNYT

NASTNSTSVTSSTATVVS
Transcript ENSMUST00000087360
Sequence
CCTTCAAGATATCCAGCAAGTTGAGACTGGGTCCCACTCTGTAGCTCCGGCTGCTGTGGAATTTACAGCATAGCCCAGAACTCGAGGCGTCTGCTTAACC

CGGCTTCTCAAATGTTGGCCTATAG - UNI683 - - UNI4941 - - UNI13892 - - UNI15611 - GAAGTTTGGTGAGCGGCCTCCACCC

AAACGACTCACTAG - UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 - GGAAGCTATGCGAAATTATTTAAAAGAACGAGGGG

ATCAAACAGTGCTCATTCTTCATGCAAAAGTTGCACAGAAGTCTTACGGAAATGAAAAACG - UNI8695 - - UNI15317 - ATTTTTTTGCCCT

CCTCCTTGTGTGTATCTTATGGGCAGTGGTTGGAAGAAAAAAAAAGAGCAAATGGAACGAGATGGATGTTCTGAACAAGAGTCTCAACCCTGTGCGTTTA

TTGGAATAGGAAACAGTGACCAAGAAATGCAGCAGCTGAACTTGGAAGGGAAG - UNI35352 - AACTACTGTACAGCCAAAACATTGTACATATCT

GATTCAGACAAGAGAAAACATTTCATGTTGTCTGTAAAGATGTTCTATGGCAACAGCGATGACATTGGTGTGTTCCTCAGCAAGCGGATAAAGGTCATCT

CCAAACCCTCCAAAAAGAAGCAGTCACTGAAGAATGCTGACT - UNI5126 - TGTGCATTGCTTCAGGAACGAAGGTGGCACTGTTCAATCGCCTTC

GGTCCCAGACAGTTAGTACCAGGTACCTGCATGTAGAAGGAGGGAATTTCCACGCCAGTTCACAACAGTGGGGAGCATTTTACATCCATCTCT - UNI4

160 - TGGACGACGACGAGTCGGAAGGAGAGGAGTTCACAGTTAGAGATGGCTACATCCATTACGGGCAGACTGTCAAGCTTGTGTGCTCAGTGACTGG

CATGGCACTCCCAAGATTG - UNI23407 - ATAATTAGGAAAGTTGATAAGCAGACGGCATTACTGGATGCAGACGACCCTGTATCACAACTCCACA

AATGTGCATTTTACCTTAAGGATACAGAAAGAATGTACTTGTGCCTTTCTCAAGAAAGAATAATCCAATTTCAG - UNI31501 - GCCACTCCATGT

CCAAAAGAACAAAATAAGGAAATGATAAACGATGGAGCTTCCTGGACAATCATTAGCACAGACAAGGCCGAGTACACGTTCTATGAGGGAATGGGCCCCG

TCCTTGCCCCAGTCACCCCTGTGCCTGTCGTAGAAAGTCTTCAG TTGAATGGCGGCGGGGACGTAGCAATGCTTGAACTTACAGGACAAAACTTTACTC

CAAATTTAAGAGTGTGGTTTGGGGATGTAGAAGCCGAAACAATGTACAG ATGTGGAGAGAGCATGCTCTGTGTGGTCCCAGACATTTCTGCATTCCGGG

AAGGTTGGAGATGGGTCCGCCAGCCAGTCCAGGTTCCAGTGACTTTGGTCCGAAATGACGGGGTCATTTACTCCACCAGCCTTACCTTCACCTACACACC

AGAGCCAGGGCCGAGGCCACACTGCAGCGCTGCAGGAGCGATTCTCAGAGCCAACTCCAGCCAAGTGCCCTCCAATGAGTCAAACACAAACAGCGAGGGG

AATTACACAAATGCCAGCACAAATTCTACCAGTGTCACATCGTCCACAGCAACCGTGGTGTCCTAACTACCGTCTTTTTGCTGGGACTGAAACTGACTTG

AATGCAGCAAAAAGTTGACAGAGAAAGGCAAGGATAAAGTGAACAATCTTTTGTGGTTTCTTGGGGAAACGTTTCGTACCAGGTGATCTATTCAAAACTG

CCAGTGCAGGTGTGACATGCAGAGGCCACAGTACAATGAACAACATCAGAATGCACAGGCTGATGGAAATCCAGGTTTTCAGCTGTCCCTCTCACACGCA

CCCCTTTTTGGTTGTTTTGGTTTGGTTTTGATTTAATGGCCAGGAAACAGATATGTGGCTGGAGCACAGGCTAAGCTAGAAGACACAAACCTAACATAGA

CTTATGGACCAAGGGACTCGCATAAGCTTTAGTGAAAGGTACATTTTCACCATGCCTTTTTTATATCACAGTGTGTACTACACCTTGTTACCAAACAGGT

TGCGCTCCCCACCCTTTGAGGGTTGGCTCTAAAGTACATTCATTCAGGTTCGAGCCTCACCATGTTTGTTCAGTCTGAACACTGAACACTTCCAGGTTCT

TGTGGTCTAAGGCTGGAACTTTTTTAAGCTGAAGTCTTATGACTTTTTCATAAGTTGGAATTATTTTGATTTCAGCAAGTCAAATTTTGTAAAGGCCTGC

ATATTTTTTTTAAGATTATATGAAGTCTGCAAAAGCTTTAAAAATGCCTCTGCCTTGCCTGCAATACATGCAATGTGTGTTAACTGAGTCTGTTCTCAGA

ATCTGTTGGTAGTTATTTCTGTGTTTTCCCTTTTTTTAAAGAAATGTATTTATAGTGGTAATCTAAGAGATGCTAACAGCTCCGTGTGGCCATTTAGCCC

TTTCTGAGTTCATGGCAGTGAGCACTGCCGTTCGAAGGCTGTGCGCCTCTGCCTGTTCATCAGTTCATCTGTGTTCCAGGATTTGTTCAGGTTTCCCCTT

CCCCCAAATCTTGTACATAACTTGTATTATGTGTAAGTTAAACATTTTATCTTTACTTGGAATGTTCCCAGTGATTACATTTCACAGGGTGTTTCCCACC

TTGTTGGCAAATGACAAAAAATATCATGCGAATTATTTGCTACCAAGATGGTGCCCGTAGGGTAAAATGAGGAACATCTCTGCAGGATGATTTATTGTAT

GTTTTCCTTTTTTTTTAGCCTAGCCAGAACATCATTATAATTTTAAAGACCATAAGATGGCTTTTATTAGATGATAACTAAATAAACTGAACTAAGTAGC

CAGAAGACAGTACCTTAGAGACTGATAGTTGTAAGTTTATAAAAATACAAATGTAACTTATATTTCCATTTTCCTCTTTGCCCCTTTGTTTATTTTCCCC

AGTAGAAATGTTCTGTCCAGATTTTTTTCCCCCTTTTTAGTTAAGCCTTGCTTGCATTCAGGCTTGTGTGTCAGCCCTGTGTGCCAATATGCCAGATTCA

TTTTGTTTCCATCCCTGCACTTTGGTTATTCCTTGTTCAGTTTCTTGGGAATTGAAGCAGACTCATTGGGCTACATTTAGTACAAGAACCACATGTGTGA

TGTTAAAGGACACAGTCTAGTGATGCCATCATCCTTGAGTAAAAACTACCTCTAGATTGTGGTAAGCTTTTACTGTCCCTTAAAACAGGAGCCACTAGTA

CCTTATGAATGCAGACTGTAACTTCTATGGCATTTTCTGGTGTCTTTCTGGCTCTCTGGGCTTCTGAAAGTTTTCACGTAGACCCTTAGACTCCTCTGTC

AGGACCATTGCTTTCCAGCGTTGCTGCTTTCACTCGCTGTCTCGAAGACTGTACCACTGTAAGTGCCACTGCGAACATCTTTAAACGGCTCCTCCTTGGC

TTGTCAAGGGGAAGGCCACCTGTAAGATGTGGTGGTGACAGCCTTCCTGTCCACCCCAGGCTGCTCCTTACCAGCTGTTCTAGCCGATTCTCTTCAGATC

AGCTACAGCCCACCTCCTCCCCGCCCCGCCTCACCCCTCCAGGCTGTCTCAGTGGTCCAGGGCAGAGCTCACTGTGGCCTTACTGATCTATCTCTGCAGT

AACTGTTCTCCCTCAGTTGCGATGGAAGCAGGCCCCTGCGATCTGTTCAGAGCCTGAGCAGTTTGCAGTTCCGTTGTGCTTTCTGAGGTCCTAGATTCAG

GATGTAGTTAAGTCGATAACTGAGAACAGATGAGATGCTTTTAAAGAACAAACTCTTCCTTACCCAGCTTTGTAGCTTAAAGTAAGTTTTCAAGTTCATG

GCTTTATTAAAATGAACTTTGACTTTTTAAAATGCTTATATCTCATTTCGGTTCTTTTGTTTATTTTAGTAAGAATTGAAACAGACTATAAGTAGTTTTC

CTGTTTGTTTGTTTGTTTGTTTGTTTTTTACAAAGTTCAAGAATGTAACAATAAAGGCATTTTGCTATGGTTCTATGTCAGACTCCTACCACAGAATAGT

GTGAACAGATATGTCTGTCTGCTTTACCATGTTATTGATAGTTCTTTTGTCAGCTGCTTTTATTAAAAGTCCTCTTTTGTGAATTTGTAAATCAATTTCA

ATATATGATGTACAGGAGTCTTGTCCCCCGTTACTGTGGAATGTTCCCCCCTGTTGATGCTGGTCCCTTTATCCTCTTATCTTCTTAGAACCGGGAATTC

TTCAGTTGTGGTGTGTGGCTGTATTTTTCTATTCTGTTTACAGTGCGTCTACACAGCTTCTTAAAACATGTCGAAATGCAGAATCCAAGATCCACCATGA

ATTTGTCAAGAGATTGGAAGGCAGGCCAAAACCTGAAAATGTGGGGTGCCCTTTGTACAATTGCAGAGTCAAGCACTAGTGGGAGTTTGAACTGGCTACT

GACCGCTCTTAAACTGTGGCAGTGTCCTTGGGTACAGTTAACTAGCAGAACCTGCTGTCACTCTTCCTGCCACCATCTTAACCTTGACAGTTTTGTTTCT

TTTCTGTGTGGTGCTGGGGTCAAATCCAGAGCCTTAGGCTTGCTAAGGCTTTTTGTTTGTTTGATTTTTCCTTGAGACAAGTGTCTCACCCATGGAGCCC

CTCAGCATTCTTGAAAGTCTCTGCCTTAGCCTCCAGGTCCTGTGGTACCAGGTGTGGCAGGATGCTTTTGTCATTAGAGAAACTGGTCTGTGTCCAACCA

CAGAAAAATTCCAATGCAGTTTTTAATAATTAATCCACTAGTTATTTAATCAAAATCTTTTTGTAGGGAGAGATTCCTGTTTGAAAGAAAATGCTATTTG

ATTATTAACCAAGGTAACAGACACTGCTTTCCAAAGCAGCTGTGTTTCTGGTGAGTACTGAACAAATGTGTGGTTTTCTGTGCCACCTTTGATTCATTTT

TCAAGCACTGTTACTCGGGATGGATGGTTAGAAACATGATATTTTAGTGTTTCTACTTAACCCTTTCAGGACCGAGCTGTATTGCCTTTCTATTAATTTC

CCCCTGTGTTGTGATAAATGTTTGCTCGTGTTCAGTCCTGTGTCAGTCCAGACGTAGGTTTGTGTAAAAGCTCAGTTGTAGCTTATTTCTTGTACCTTGC

AGCATGTTCTACGCATCCAGTCCTTAAGGGGTTTACTCTACAAACTGTGCACCTGCGTGTAAGGGTCATTAGCAATAAGATAGAAAATTGAGCAAGTTTA

TACCATAATTTTGTAGAAAAAGGAATCTGCTCAATTCCATATTTCATCCATGAAAACTCTGCAATACGGGCAGTTTCTAGGAATAAATAAAAAGGAGATG

CAAACCATTGTAGATGTCTTCTGTGGGATGTGCCCGATGCGTGCATCATCGTCTTTGATTCCAGGTACTTCATAAAGATAAAATTAAATTC
Translation
DWVPLCSSGCCGIYSIAQNSRRLLNPASQMLAYR - UNI683 - - UNI4941 - - UNI13892 - - UNI15611 - RKFGERPPPKRLTR -

 UNI2686 - - UNI8695 - - UNI13892 - - UNI30301 - REAMRNYLKERGDQTVLILHAKVAQKSYGNEKR - UNI8695 - - UNI

15317 - RFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK - UNI35352 - NYCTAKTLYISDSDKRKHFMLS

VKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADL - UNI5126 - LCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLL - 

UNI4160 - LDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL - UNI23407 - IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL

SQERIIQFQ - UNI31501 - ATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQ LNGGGDVAMLELTGQNFTPNLRVW

FGDVEAETMYR RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPSNESNTNSEGNYTN

ASTNSTSVTSSTATVVS

For any suggestions or comments, please send an email to unitrap@crg.es