Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039199 (Zdhhc1)
Chromosomal location
Chr 8: 107996325 - 108008330 (-)
Description
zinc finger, DHHC domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1918046]
RefSeq_dna
NM_175160 
RefSeq_peptide
NP_780369.1 
MGI
MGI:1918046 
Uniprot/SWISSPROT
Q8R0N9 
Uniprot/SPTREMBL
Q0VE36 
Human Ortholog
ENSG00000159714 (ZDHHC1)
Omim not available
UniTrap UNI34042
Vector Insertion
Chr 8: 108007440 - 108008331
Public Clones IST12491F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34341
Vector Insertion
Chr 8: 108002651 - 108007684
Public Clones IST14827A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044286
Sequence
AAGGAATCAAAGAAGAGTCCTCCCTTCTCTTGTGTGCGGGCTCATCCCCAGCTGAGAAACCAGAAAGAACCCCTCTGAAGCCCAGGGGAGAAGTTGTTGG

TCCCTGGTCCTAAAGGGATTATGTGCCTGCCAAGCAGTGAGCAGTGAGGCCAGCTCTCTCTGAACACCCCCACTGCCTGTTTCCTTCAGCAAAGAAGAAG

GGGCCCCCCTCTCTGACACTTGATTTGGATCTCAGGACGGAG - UNI34042 - - UNI34341 - ATGAACATCTGCAACAAACCCTCCAACAAGA

CAGCCCCCGAGAAGAGTGTGTGGACAGCGCCCTCACAGGACAGTGGGCCTTCCCCAGAACTGCAGGGCCAGCGCTCTCGAAGGAATGGATGGAGCTGGCC

GCCCCACCCGCTCCAGATTGTGGCCTGGCTGCTCTACCTCTTCTTCGCGGTGATTGGCTTTGGGGTCCTTGTTCCCCTCTTGCCTCACCACTGGGTGCCT

GCTGGCTATGCT - UNI34042 - - UNI34341 - TGCATGGGGGCCATCTTTGCTGGCCACCTTGTGGTGCACCTGACTGCTGTCTCCATCGATC

CAGCAGATGCCAATGTGCGGGACAAGAGCTACTCTGGGCCCCTGCCCATCTTCAACCGCAGCCAGCATGCGCATGTCATTGAAGACCTGCACTGCAACCT

ATGCGACGTGGACGT - UNI34341 - GAGTGCGCGATCCAAACACTGCAGCGCCTGCAATAAGTGCGTATGCGGCTTCGATCACCATTGCAAGTGGC

TCAACAACTGCGTGGGCGAGAGGAACTATCG GCTCTTTCTACACAGTGTGGCATCTGCTTTATTGGGTGTCCTGCTCCTGGTGCTGGTGGCCACTTATG

TCTTCGTGGAGTTCTTTGTCAACCCCATGCGACTTCGTACCAACCAACACTTTGAAG TCTTGAAGAACCACACGGATGTGTGGTTTGTGTTCTTGCCTG

CTGCCCCTGTGGAGACCCAGGCTCCTGCCATCCTGGCCCTGGCCGCCCTGCTCATCCTTCTGGGCCTGCTTTCTACAGCCCTGCTTGGCCACCTGCTCTG

CTTCCACATTTATCTAA TGTGGCACAAGCTCACCACCTATGAATACATCGTGCAGCACCGTCCAGCTCAGGAAGCAAAGGAGACCCACAAGGAGCTGGA

GTCATGCCCCCGCAAGGTGCGGTCCATTCAG GAGATGGAGTTCTACATGAGGACCTTCAGCCATGTGCGTCCAGAGCCCTCTGGCCAGGCTAGGACAGC

AGCATTAAATGCCAA TCCTTCCCAGTTTCTTGCCACCCAAGGCCAAGTGGAACCACCACTACCCTCCTCCTCAGACACACTGGCTCTGCCTCCACGGAT

CCAACCCCAG AAAAAGAGGAAGCGGCGAGTGTATAGATTGCCCAGGTCTGGGGTCTTGGACCGAGAGCTCCCACTGCCCAGGTTACGGG AGACTGGGA

CTCCTAGCCGCCGCTCCAGCTCTTCATCTGATTCCACCAGTGCCAGCCCAGTGCATGCTGGTGGCTCTGCAGGCGCCTACTACTCGGCATCAGCTGAGTC

CATGGAAGAGATTCCAGTGGCCCAGACGCGCCTGGGCAGTGCCGCACTGGGTGCCCCAGGAGCCAGGGGTCGAGAGTCTGGGCTGGCTCTACAGGCACGT

TCGCCTGCTGTTTTTGTGAGCCCGAGCAGTGGCGAGCCCGGAACACCTGGAGGCGGCGACGGCCTGCCTTAGCCCACTAAGGCTAAGGACTAGAGGCAGG

AGGGCCTTGACTCTATGCAACACCCCACATTCGCGTAACGAGTGCACTTTAGGGACCTCAAGGTCGACAGGATCGGCCTTCCTTACCCAAGACTCAGCAA

TATCCGCTCCACCAGCCCTGATGCCCCAATAAACTTTTTTTTTTTTTT
Translation
 - UNI34042 - - UNI34341 - MNICNKPSNKTAPEKSVWTAPSQDSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYLFFAVIGFGVLVPLLPH

HWVPAGYA - UNI34042 - - UNI34341 - CMGAIFAGHLVVHLTAVSIDPADANVRDKSYSGPLPIFNRSQHAHVIEDLHCNLCDVDV - UNI

34341 - VSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYR RLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNQHFEV VLKNHTDVWFVF

LPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLM MWHKLTTYEYIVQHRPAQEAKETHKELESCPRKVRSIQ EMEFYMRTFSHVRPEPSG

QARTAALNAN NPSQFLATQGQVEPPLPSSSDTLALPPRIQPQ KKRKRRVYRLPRSGVLDRELPLPRLRE ETGTPSRRSSSSSDSTSASPVHAGGSAG

AYYSASAESMEEIPVAQTRLGSAALGAPGARGRESGLALQARSPAVFVSPSSGEPGTPGGGDGLP

For any suggestions or comments, please send an email to unitrap@crg.es