Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039220 (Ppp1r10)
Chromosomal location
Chr 17: 36053511 - 36069217 (+)
Description
protein phosphatase 1, regulatory subunit 10 Gene [Source:MGI (curated);Acc:Ppp1r10-001]
RefSeq_peptide
NP_787948.1 
UniGene
Mm.29385 Mm.458452 
MGI
MGI:1289273 
Uniprot/SWISSPROT
Q80W00 
Uniprot/SPTREMBL
A0PJI3 B1B179 Q3ULI5 Q99KB0 
Human Ortholog
ENSG00000204569 (PPP1R10)
Omim not available
UniTrap UNI2151
Vector Insertion
Chr 17: 36053544 - 36054140
Public Clones (sanger) XT0756 (sanger) P106F02 (ggtc) D004C09 (ggtc) 5SP146H05 (ggtc)
PST13504-NL (escells) PST5635-NL (escells) PST11944-NL (escells) PST13897-NL (escells)
PST292-1 (escells) PSTVU01.5A2 (vanderbilt) IST10893G2 (tigm) IST14384C7 (tigm)
Private Clones OST431936 (lexicon) OST266921 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10120
Vector Insertion
Chr 17: 36054142 - 36054662
Public Clones GST071 (baygenomics) M030C07 (ggtc) M044B02 (ggtc) D032C11 (ggtc)
M063C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15043
Vector Insertion
Chr 17: 36054662 - 36060252
Public Clones (sanger) D022A03 (ggtc) P135H12 (ggtc) E078C11 (ggtc) P123D06 (ggtc)
D034B06 (ggtc) PST14209-NL (escells) IST11093B1 (tigm) IST14193F9 (tigm)
IST11183C8 (tigm) IST11722B1 (tigm) IST14414H4 (tigm) IST14793G3 (tigm)
Private Clones OST376074 (lexicon) OST351989 (lexicon) OST346550 (lexicon) OST291553 (lexicon)
OST280275 (lexicon) OST210198 (lexicon) OST112408 (lexicon) OST95998 (lexicon)
OST92599 (lexicon) OST80793 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5538
Vector Insertion
Chr 17: 36060252 - 36060371
Public Clones YTA182 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18339
Vector Insertion
Chr 17: 36060371 - 36060981
Public Clones not available
Private Clones OST425363 (lexicon) OST308064 (lexicon) OST209849 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1370
Vector Insertion
Chr 17: 36061069 - 36061189
Public Clones CJ0276 (sanger)
Private Clones OST351942 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI359
Vector Insertion
Chr 17: 36061855 - 36063146
Public Clones GC0982 (tigem)
Private Clones OST57731 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087211
Sequence
CCGGACCAGTCACGATGAATCCTAGATTCCATG - UNI2151 - - UNI10120 - GTTGAATTTTCTCGGAGAAAGACAGGCCGGCCATCAGGAAA

ACAAACAAGCCTCAGCAACATCTAAACCCTTGAAAGGATCCTGAGAGGGGGGAAAGGGAAATCAGCCACCAGCCCAACCACTCGTGTCTTCTGCCCCTCC

CCACCTATCTTGCCCACCCCACCAGCCCACGCTGCTTGGGACTTGAGATCTGTGGCCGAAGGACCGTCACCACATAACTTCAAAAATAATCAACCACCTT

CCCTGCCCAAACCTACCCAATCTCACTCATCCAGCATTTCCGTTTTGGAATCCACTCAGACTTTTTTTTTCAACGACCCCCTCTCCCTAAATGGAGTTGG

GCGGGGGGGAAATGAAAACTGAGTTGGTCTTTACTTTTTTTAAAAGAGACTTTTTGATCCAATGAGGCCCCACAAGTAACTGAGTTTGGGTCCTGGTTGG

TTGCTTTATTTTTTTTCCTCCAAAATTTTACCCCTCCCCCCTGAGCCCGAGGTGCTGACGTCGCAAAAAAATTGGATA - UNI5538 - - UNI1012

0 - - UNI15043 - AAGCCACCATCATGGGTTCAGGTCCCATAGACCCCAAAGAACTGCTCAAGGGCCTGGATAGCTTCCTTACCCGGGACGGAGAA

GTGAAGAGTGTGGATGGAATTTCCAAGATCTTCAG - UNI5538 - - UNI18339 - TCTAATGAAGGAGGCACGAAAGATGGTGAGTCGGTGCAC

GTACTTGAACATAATCCTGCAGACCCGCGCTCCAGAAGTGCTCGTCAA - UNI1370 - GTTTATTGATGTCGGTGGCTACAAGCTTCTGAACAACTG

GCTAACATATTCAAAGACCACCAACAACATTCCTCTCCTACAGCAGATTCTGCTGACTCTGCAGCACCTCCCGCTCACTGTGGACCATCTCAAGCAG AA

CAACACAGCAAAACTAGTGAAGCAGCTCAGCAAGTCAAGTGAGGATGAAG - UNI359 - AGCTCCGGAAATTGGCATCAGTCCTTGTCAGTGACTGG

ATGGCTGTCATCCGCTCCCAGAGTAGCACCCAGCCTGCAG AGAAAGATAAGAAGAAAAGGAAGGAAGAGGGGAAAAGTCGAACCACGCTTCCTGAGCGG

CCTTTGACTGAAGTGAAGGCTGAGACCCGGGCTGAGGAAGCCCCAGAGAAGAAGAAAGAGAAGCCCAAGTCACTTAGAACTACGGCACCCAGTCATGCCA

AGTTCCGTTCTACTG GACTGGAGCTGGACACCCCATCTTTGGTGCCTGTGAAGAAGAACTCCAGCACTGTGGTTGTGTCAGACAAGTACAACCTGAAGC

CCATCCCCCTGAAGCGGCAGAG TGCCACAGCTGCTCCAGGTGACGCTGCCCCACCTGCAGAGAAGAAATACAAGCCTCTCAACACAGCCCCCAATACCA

CCAAAGAAATCAAAGTGAAGATCATCCCTCCACAGC CTATGGAGGGCCTGGGTTTTCTGGATGCTCTCAATTCAGCCCCTGTCCCAGGCATCAAAATTA

AGAAGAAGAAGAAGGTACTATCGCCGACTGCTGCCAAG CCCAGCCCTTTTGAAGGGAAAACAAGCACCGAGCAGAGCACAGCCAAACCTTCCTCCCCAG

AGCCTGCACCACCTGCTGAGCCCATGGACACGGACCGCCCTGGCACCCCTGTTCCCCCTGTTGAAGTTCCAGAGCTCATGGATGCAG CCTCTTCAGAGC

CAGGAGCTCTGGATGCAAAGCCTGTGGACAGCCCTGGAGATCCCAACCAGCTGACTCGCAAGGGCAGAAAGAGGAAAACTGTGACTTGGCCTGAGGAGGG

CAAGCTGAGAGAGTATTTCTACTTTGAACTGGACGAAACTGAGCGAG TGAATGTGAACAAGATCAAAGACTTCGGGGAGGCTGCTAAGCGTGAGATACT

GTCTGACCGACATGCTTTCGAGACAGCTCGGCGACTAAGCCATGACAATATGGAGGAGAAAGTGCCTTGGGTGTGTCCCAGGCCTCTGGTTCTGCCCTCA

CCTCTTGTCATCCCTGGAAGCAACAGCCAGGAGCGATACATCCAGGCAGAGCGGGAGAAGGGCATCCTTCAGGAACTCTTCCTGAACAAGGAGAG TCCA

CATGAACCTGATCCTGAGCCATATGAACCCATTCCCCCAAAACTCATCCCCTTGGATGAG GAATGTGCCATGGATGAGACTCCATATGTCGAGACCCTG

GAGCCTGGAGGGTCTGGTGGCTCACCTGATGGAGCAGGAGGCTCCAAGCTGCCTCCAGTTCTGGCCAATCTTATGGGAAGCATGGGAGCTGGAAAGAGCC

CCCAGGGCCCTGGAGGAGGCGGCATCAATGTTCAGGAGATCCTCACTTCCATAATG GGCAGTCCAAACAGCCACCCTTCAGAGGAGCTGCTGAAGCAGC

CTGACTACTCAGACAAGCTCAAGCAGATGCTGG TGCCTCATGGGCTCCTAGGTCCTGGTCCTGTGGCCAATGGCTTTCCACCAGGAGGCCCTGGGGGCC

CGAAGGGTATGCAGCATTTCCCCCCTGGTCCTGGAGGGCCCATGCCAG GTCCCCATGGAGGCCCTGGTGGACCAGTGGGTCCACGTCTCTTAGGTCCCC

CACCACCTTCTCGGGGAGGTGATCCATTCTGGGATGGCCCAGGTGATCCAATGCGAGGTGGCCCAATGCGTGGGGGTCCAGGACCTGCTCCCGGACCATA

CCACAGAGGCCGAGGGGGTCGAGGAGGAAATGAGCCACCGCCACCACCTCCATTCCGAGGAGCCAGAGGAGGTCGTTCCGGAGGAGGACCACCAAATGGC

CGAGGGGGTCCTGGTGGAGGAGGCATGGTTGGAGGTGGTGGGCACCGCCCCCATGAAGGCCCTGGAGGGAGCATGGGCAGTGGACATCGTTCCCATGATG

GCCCTGGAGGGAACATGGGCAGTGGACATCGTTCTCATGATGGCCCTGGAGGGAACATGGGTGGAAGTGGTGGACATCGTTCCCATGAAGGCCCTGGACA

CGGAGGACCCCATGGACACCGACCACATGATGTCCCTAGCCATCGAGGCCACGACCATCGAGGGCCACCACCTCATGAACACCGTGGTCATGATGGCCAT

GGGGGAGGCGGCCACCGAGGGCATGATGGAGGCCACAGTCATGGAGGAG ACATGTCAAACCGCCCTGTCTGCCGACACTTCATGATGAAGGGCAACTGC

CGCTATGAGAACAACTGTGCCTTCTACCACCCAGGGGTCAATGGGCCCCCACTGCCCTAGCCTGCCTGCCCTACCCGCACCCCTGTGGACTGCAGCCTTG

CTCCTTCCACTTGGTTATGGCTTCTGTGAGGCCCACTGTCCTTTTCCCCAGCTGATGAGGAGCCGGCCCCCTCAGTTCCCACCTGGTTGGGTTTCTGGGG

GTTTCTGATTCCTGGTGTGCATTGATGTACATAGTCCCCTCCAGTCTGGAGAGGAGAGAGACTGGACACACTCTAGATGCTGGACTGCTGAGACGGCTGG

CTTCACTCTGTGAGGAGATTTGCCCTGTGCCCCAAACCCTTTCCAGTATTAGCCCCGCTGCCTGAGAACCTAAAGCTGGTCACTCTGGAGACCTCTGCTC

TCCACATGCACACAGAACTAAGTGGGTCAGCTGCACTTAGGAAACCATCTAAGCTAAGCTCATTATCCTCACAGGGCGAGGGGGTGGTGAGGGGTACCAT

CTATCCCACTGCACTGCACTGCACTGCACTGAGGGCTCAAGCTGGCTGAAGCTGAGTTCTGGAACCACCCCCACTTGTGCCCCACATGGGCCAGTCACTG

TTGAGTCCTTTCTCAAGAAAGACTGCAACTGTTACTTCCCAGGTCATCGTGGGTCTGCTAGGTTCAGTGATGGCACGTTCACATCTGTATCCAAGGAAGT

TGTTATCTGGCAGAGGGGCATCCTGTAGTGTTGGGCCACTCCTGCCTACAGCGGTATTAGAGACTCCGTGAGACCAGCTTTCATTAACTTTAGCCGGGTA

CAGCGGGCCTGAAACACTACATGCACTGCCTTTGGGAGTGGGCCTGCTCCTTCCTTACCCCATGAGGAGCCCTGTCTGAGGCTTCCTGGGCAGACTCAGC

AGTAGGGGCCCTTCCCAGTCGTCTCCTCCCCTTGTCTTGGCATCAGTTGTTTTCTATGAAAACAGTGGGTTGGTTTTGTGAAGGGTCTTGGGTTAGAACC

ACAATGGATTTGAGGAGTTTTTCTTTTGGTTTTGTATATTTTGTACATTAATAATAAACAGTGGAAAGAGAAGC
Translation
 - UNI2151 - - UNI10120 -  - UNI5538 - - UNI10120 - - UNI15043 - MGSGPIDPKELLKGLDSFLTRDGEVKSVDGISKIF

S - UNI5538 - - UNI18339 - SLMKEARKMVSRCTYLNIILQTRAPEVLVK - UNI1370 - KFIDVGGYKLLNNWLTYSKTTNNIPLLQQI

LLTLQHLPLTVDHLKQ NNTAKLVKQLSKSSEDEE - UNI359 - ELRKLASVLVSDWMAVIRSQSSTQPAE EKDKKKRKEEGKSRTTLPERPLTEV

KAETRAEEAPEKKKEKPKSLRTTAPSHAKFRSTG GLELDTPSLVPVKKNSSTVVVSDKYNLKPIPLKRQS SATAAPGDAAPPAEKKYKPLNTAPNTTK

EIKVKIIPPQP PMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAK PSPFEGKTSTEQSTAKPSSPEPAPPAEPMDTDRPGTPVPPVEVPELMDAA AS

SEPGALDAKPVDSPGDPNQLTRKGRKRKTVTWPEEGKLREYFYFELDETERV VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPL

VLPSPLVIPGSNSQERYIQAEREKGILQELFLNKES SPHEPDPEPYEPIPPKLIPLDE ECAMDETPYVETLEPGGSGGSPDGAGGSKLPPVLANLMGS

MGAGKSPQGPGGGGINVQEILTSIM GSPNSHPSEELLKQPDYSDKLKQMLV VPHGLLGPGPVANGFPPGGPGGPKGMQHFPPGPGGPMPG GPHGGPG

GPVGPRLLGPPPPSRGGDPFWDGPGDPMRGGPMRGGPGPAPGPYHRGRGGRGGNEPPPPPPFRGARGGRSGGGPPNGRGGPGGGGMVGGGGHRPHEGPGG

SMGSGHRSHDGPGGNMGSGHRSHDGPGGNMGGSGGHRSHEGPGHGGPHGHRPHDVPSHRGHDHRGPPPHEHRGHDGHGGGGHRGHDGGHSHGGD DMSNR

PVCRHFMMKGNCRYENNCAFYHPGVNGPPLP
Transcript ENSMUST00000113771
Sequence
AGGTTGAATTTTCTCGGAGAAAGACAGGCCGGCCATCAGGAAAACAAACAAGCCTCAGCAACATCTAAACCCTTGAAAGGATCCTGAGAGGGGGGAAAGG

GAAATCAGCCACCAGCCCAACCACTCGTGTCTTCTGCCCCTCCCCACCTATCTTGCCCACCCCACCAGCCCACGCTGCTTGGGACTTGAGATCTGTGGCC

GAAGGACCGTCACCACATAACTTCAAAAATAATCAACCACCTTCCCTGCCCAAACCTACCCAATCTCACTCATCCAGCATTTCCGTTTTGGAATCCACTC

AGACTTTTTTTTTCAACGACCCCCTCTCCCTAAATGGAGTTGGGCGGGGGGGAAATGAAAACTGAGTTGGTCTTTACTTTTTTTAAAAGAGACTTTTTGA

TCCAATGAGGCCCCACAAGTAACTGAGTTTGGGTCCTGGTTGGTTGCTTTATTTTTTTTCCTCCAAAATTTTACCCCTCCCCCCTGAGCCCGAGGTGCTG

ACGTCGCAAAAAAATTGGATA - UNI5538 - - UNI10120 - - UNI15043 - AAGCCACCATCATGGGTTCAGGTCCCATAGACCCCAAAGA

ACTGCTCAAGGGCCTGGATAGCTTCCTTACCCGGGACGGAGAAGTGAAGAGTGTGGATGGAATTTCCAAGATCTTCAG - UNI5538 - - UNI1833

9 - TCTAATGAAGGAGGCACGAAAGATGGTGAGTCGGTGCACGTACTTGAACATAATCCTGCAGACCCGCGCTCCAGAAGTGCTCGTCAA - UNI137

0 - GTTTATTGATGTCGGTGGCTACAAGCTTCTGAACAACTGGCTAACATATTCAAAGACCACCAACAACATTCCTCTCCTACAGCAGATTCTGCTGAC

TCTGCAGCACCTCCCGCTCACTGTGGACCATCTCAAGCAG AACAACACAGCAAAACTAGTGAAGCAGCTCAGCAAGTCAAGTGAGGATGAAG - UNI3

59 - AGCTCCGGAAATTGGCATCAGTCCTTGTCAGTGACTGGATGGCTGTCATCCGCTCCCAGAGTAGCACCCAGCCTGCAG AGAAAGATAAGAAGAA

AAGGAAGGAAGAGGGGAAAAGTCGAACCACGCTTCCTGAGCGGCCTTTGACTGAAGTGAAGGCTGAGACCCGGGCTGAGGAAGCCCCAGAGAAGAAGAAA

GAGAAGCCCAAGTCACTTAGAACTACGGCACCCAGTCATGCCAAGTTCCGTTCTACTG GACTGGAGCTGGACACCCCATCTTTGGTGCCTGTGAAGAAG

AACTCCAGCACTGTGGTTGTGTCAGACAAGTACAACCTGAAGCCCATCCCCCTGAAGCGGCAGAG TGCCACAGCTGCTCCAGGTGACGCTGCCCCACCT

GCAGAGAAGAAATACAAGCCTCTCAACACAGCCCCCAATACCACCAAAGAAATCAAAGTGAAGATCATCCCTCCACAGC CTATGGAGGGCCTGGGTTTT

CTGGATGCTCTCAATTCAGCCCCTGTCCCAGGCATCAAAATTAAGAAGAAGAAGAAGGTACTATCGCCGACTGCTGCCAAG CCCAGCCCTTTTGAAGGG

AAAACAAGCACCGAGCAGAGCACAGCCAAACCTTCCTCCCCAGAGCCTGCACCACCTGCTGAGCCCATGGACACGGACCGCCCTGGCACCCCTGTTCCCC

CTGTTGAAGTTCCAGAGCTCATGGATGCAG CCTCTTCAGAGCCAGGAGCTCTGGATGCAAAGCCTGTGGACAGCCCTGGAGATCCCAACCAGCTGACTC

GCAAGGGCAGAAAGAGGAAAACTGTGACTTGGCCTGAGGAGGGCAAGCTGAGAGAGTATTTCTACTTTGAACTGGACGAAACTGAGCGAG TGAATGTGA

ACAAGATCAAAGACTTCGGGGAGGCTGCTAAGCGTGAGATACTGTCTGACCGACATGCTTTCGAGACAGCTCGGCGACTAAGCCATGACAATATGGAGGA

GAAAGTGCCTTGGGTGTGTCCCAGGCCTCTGGTTCTGCCCTCACCTCTTGTCATCCCTGGAAGCAACAGCCAGGAGCGATACATCCAGGCAGAGCGGGAG

AAGGGCATCCTTCAGGAACTCTTCCTGAACAAGGAGAG TCCACATGAACCTGATCCTGAGCCATATGAACCCATTCCCCCAAAACTCATCCCCTTGGAT

GAG GAATGTGCCATGGATGAGACTCCATATGTCGAGACCCTGGAGCCTGGAGGGTCTGGTGGCTCACCTGATGGAGCAGGAGGCTCCAAGCTGCCTCCA

GTTCTGGCCAATCTTATGGGAAGCATGGGAGCTGGAAAGAGCCCCCAGGGCCCTGGAGGAGGCGGCATCAATGTTCAGGAGATCCTCACTTCCATAATG 

GGCAGTCCAAACAGCCACCCTTCAGAGGAGCTGCTGAAGCAGCCTGACTACTCAGACAAGCTCAAGCAGATGCTGG TGCCTCATGGGCTCCTAGGTCCT

GGTCCTGTGGCCAATGGCTTTCCACCAGGAGGCCCTGGGGGCCCGAAGGGTATGCAGCATTTCCCCCCTGGTCCTGGAGGGCCCATGCCAG GTCCCCAT

GGAGGCCCTGGTGGACCAGTGGGTCCACGTCTCTTAGGTCCCCCACCACCTTCTCGGGGAGGTGATCCATTCTGGGATGGCCCAGGTGATCCAATGCGAG

GTGGCCCAATGCGTGGGGGTCCAGGACCTGCTCCCGGACCATACCACAGAGGCCGAGGGGGTCGAGGAGGAAATGAGCCACCGCCACCACCTCCATTCCG

AGGAGCCAGAGGAGGTCGTTCCGGAGGAGGACCACCAAATGGCCGAGGGGGTCCTGGTGGAGGAGGCATGGTTGGAGGTGGTGGGCACCGCCCCCATGAA

GGCCCTGGAGGGAGCATGGGCAGTGGACATCGTTCCCATGATGGCCCTGGAGGGAACATGGGCAGTGGACATCGTTCTCATGATGGCCCTGGAGGGAACA

TGGGTGGAAGTGGTGGACATCGTTCCCATGAAGGCCCTGGACACGGAGGACCCCATGGACACCGACCACATGATGTCCCTAGCCATCGAGGCCACGACCA

TCGAGGGCCACCACCTCATGAACACCGTGGTCATGATGGCCATGGGGGAGGCGGCCACCGAGGGCATGATGGAGGCCACAGTCATGGAGGAG ACATGTC

AAACCGCCCTGTCTGCCGACACTTCATGATGAAGGGCAACTGCCGCTATGAGAACAACTGTGCCTTCTACCACCCAGGGGTCAATGGGCCCCCACTGCCC

TAG
Translation
 - UNI5538 - - UNI10120 - - UNI15043 - MGSGPIDPKELLKGLDSFLTRDGEVKSVDGISKIFS - UNI5538 - - UNI18339 -

 SLMKEARKMVSRCTYLNIILQTRAPEVLVK - UNI1370 - KFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQ NNTAKLVKQ

LSKSSEDEE - UNI359 - ELRKLASVLVSDWMAVIRSQSSTQPAE EKDKKKRKEEGKSRTTLPERPLTEVKAETRAEEAPEKKKEKPKSLRTTAPS

HAKFRSTG GLELDTPSLVPVKKNSSTVVVSDKYNLKPIPLKRQS SATAAPGDAAPPAEKKYKPLNTAPNTTKEIKVKIIPPQP PMEGLGFLDALNSA

PVPGIKIKKKKKVLSPTAAK PSPFEGKTSTEQSTAKPSSPEPAPPAEPMDTDRPGTPVPPVEVPELMDAA ASSEPGALDAKPVDSPGDPNQLTRKGRK

RKTVTWPEEGKLREYFYFELDETERV VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVIPGSNSQERYIQAEREKGI

LQELFLNKES SPHEPDPEPYEPIPPKLIPLDE ECAMDETPYVETLEPGGSGGSPDGAGGSKLPPVLANLMGSMGAGKSPQGPGGGGINVQEILTSIM 

GSPNSHPSEELLKQPDYSDKLKQMLV VPHGLLGPGPVANGFPPGGPGGPKGMQHFPPGPGGPMPG GPHGGPGGPVGPRLLGPPPPSRGGDPFWDGPGD

PMRGGPMRGGPGPAPGPYHRGRGGRGGNEPPPPPPFRGARGGRSGGGPPNGRGGPGGGGMVGGGGHRPHEGPGGSMGSGHRSHDGPGGNMGSGHRSHDGP

GGNMGGSGGHRSHEGPGHGGPHGHRPHDVPSHRGHDHRGPPPHEHRGHDGHGGGGHRGHDGGHSHGGD DMSNRPVCRHFMMKGNCRYENNCAFYHPGVN

GPPLP
Transcript ENSMUST00000087210
Sequence
AGGTTGAATTTTCTCGGAGAAAGACAGGCCGGCCATCAGGAAAACAAACAAGCCTCAGCAACATCTAAACCCTTGAAAGGATCCTGAGAGGGGGGAAAGG

GAAATCAGCCACCAGCCCAACCACTCGTGTCTTCTGCCCCTCCCCACCTATCTTGCCCACCCCACCAGCCCACGCTGCTTGGGACTTGAGATCTGTGGCC

GAAGGACCGTCACCACATAACTTCAAAAATAATCAACCACCTTCCCTGCCCAAACCTACCCAATCTCACTCATCCAGCATTTCCGTTTTGGAATCCACTC

AGACTTTTTTTTTCAACGACCCCCTCTCCCTAAATGGAGTTGGGCGGGGGGGAAATGAAAACTGAGTTGGTCTTTACTTTTTTTAAAAGAGACTTTTTGA

TCCAATGAGGCCCCACAAGTAACTGAGTTTGGGTCCTGGTTGGTTGCTTTATTTTTTTTCCTCCAAAATTTTACCCCTCCCCCCTGAGCCCGAGGTGCTG

ACGTCGCAAAAAAATTGGATA - UNI5538 - - UNI10120 - - UNI15043 - AAGCCACCATCATGGGTTCAGGTCCCATAGACCCCAAAGA

ACTGCTCAAGGGCCTGGATAGCTTCCTTACCCGGGACGGAGAAGTGAAGAGTGTGGATGGAATTTCCAAGATCTTCAG - UNI5538 - - UNI1833

9 - TCTAATGAAGGAGGCACGAAAGATGGTGAGTCGGTGCACGTACTTGAACATAATCCTGCAGACCCGCGCTCCAGAAGTGCTCGTCAA - UNI137

0 - GTTTATTGATGTCGGTGGCTACAAGCTTCTGAACAACTGGCTAACATATTCAAAGACCACCAACAACATTCCTCTCCTACAGCAGATTCTGCTGAC

TCTGCAGCACCTCCCGCTCACTGTGGACCATCTCAAGCAG AACAACACAGCAAAACTAGTGAAGCAGCTCAGCAAGTCAAGTGAGGATGAAG - UNI3

59 - AGCTCCGGAAATTGGCATCAGTCCTTGTCAGTGACTGGATGGCTGTCATCCGCTCCCAGAGTAGCACCCAGCCTGCAG AGAAAGATAAGAAGAA

AAGGAAGGAAGAGGGGAAAAGTCGAACCACGCTTCCTGAGCGGCCTTTGACTGAAGTGAAGGCTGAGACCCGGGCTGAGGAAGCCCCAGAGAAGAAGAAA

GAGAAGCCCAAGTCACTTAGAACTACGGCACCCAGTCATGCCAAGTTCCGTTCTACTG GACTGGAGCTGGACACCCCATCTTTGGTGCCTGTGAAGAAG

AACTCCAGCACTGTGGTTGTGTCAGACAAGTACAACCTGAAGCCCATCCCCCTGAAGCGGCAGAG TGCCACAGCTGCTCCAGGTGACGCTGCCCCACCT

GCAGAGAAGAAATACAAGCCTCTCAACACAGCCCCCAATACCACCAAAGAAATCAAAGTGAAGATCATCCCTCCACAGC CTATGGAGGGCCTGGGTTTT

CTGGATGCTCTCAATTCAGCCCCTGTCCCAGGCATCAAAATTAAGAAGAAGAAGAAGGTACTATCGCCGACTGCTGCCAAG CCCAGCCCTTTTGAAGGG

AAAACAAGCACCGAGCAGAGCACAGCCAAACCTTCCTCCCCAGAGCCTGCACCACCTGCTGAGCCCATGGACACGGACCGCCCTGGCACCCCTGTTCCCC

CTGTTGAAGTTCCAGAGCTCATGGATGCAG CCTCTTCAGAGCCAGGAGCTCTGGATGCAAAGCCTGTGGACAGCCCTGGAGATCCCAACCAGCTGACTC

GCAAGGGCAGAAAGAGGAAAACTGTGACTTGGCCTGAGGAGGGCAAGCTGAGAGAGTATTTCTACTTTGAACTGGACGAAACTGAGCGAG TGAATGTGA

ACAAGATCAAAGACTTCGGGGAGGCTGCTAAGCGTGAGATACTGTCTGACCGACATGCTTTCGAGACAGCTCGGCGACTAAGCCATGACAATATGGAGGA

GAAAGTGCCTTGGGTGTGTCCCAGGCCTCTGGTTCTGCCCTCACCTCTTGTCATCCCTGGAAGCAACAGCCAGGAGCGATACATCCAGGCAGAGCGGGAG

AAGGGCATCCTTCAGGAACTCTTCCTGAACAAGGAGAG TCCACATGAACCTGATCCTGAGCCATATGAACCCATTCCCCCAAAACTCATCCCCTTGGAT

GAG GAATGTGCCATGGATGAGACTCCATATGTCGAGACCCTGGAGCCTGGAGGGTCTGGTGGCTCACCTGATGGAGCAGGAGGCTCCAAGCTGCCTCCA

GTTCTGGCCAATCTTATGGGAAGCATGGGAGCTGGAAAGAGCCCCCAGGGCCCTGGAGGAGGCGGCATCAATGTTCAGGAGATCCTCACTTCCATAATG 

GGCAGTCCAAACAGCCACCCTTCAGAGGAGCTGCTGAAGCAGCCTGACTACTCAGACAAGCTCAAGCAGATGCTGG TGCCTCATGGGCTCCTAGGTCCT

GGTCCTGTGGCCAATGGCTTTCCACCAGGAGGCCCTGGGGGCCCGAAGGGTATGCAGCATTTCCCCCCTGGTCCTGGAGGGCCCATGCCAG GTCCCCAT

GGAGGCCCTGGTGGACCAGTGGGTCCACGTCTCTTAGGTCCCCCACCACCTTCTCGGGGAGGTGATCCATTCTGGGATGGCCCAGGTGATCCAATGCGAG

GTGGCCCAATGCGTGGGGGTCCAGGACCTGCTCCCGGACCATACCACAGAGGCCGAGGGGGTCGAGGAGGAAATGAGCCACCGCCACCACCTCCATTCCG

AGGAGCCAGAGGAGGTCGTTCCGGAGGAGGACCACCAAATGGCCGAGGGGGTCCTGGTGGAGGAGGCATGGTTGGAGGTGGTGGGCACCGCCCCCATGAA

GGCCCTGGAG GGAACATGGGCAGTGGACATCGTTCTCATGATGGCCCTGGAGGGAACATGGGTGGAAGTGGTGGACATCGTTCCCATGAAGGCCCTGGA

CACGGAGGACCCCATGGACACCGACCACATGATGTCCCTAGCCATCGAGGCCACGACCATCGAGGGCCACCACCTCATGAACACCGTGGTCATGATGGCC

ATGGGGGAGGCGGCCACCGAGGGCATGATGGAGGCCACAGTCATGGAGGAG ACATGTCAAACCGCCCTGTCTGCCGACACTTCATGATGAAGGGCAACT

GCCGCTATGAGAACAACTGTGCCTTCTACCACCCAGGGGTCAATGGGCCCCCACTGCCCTAG
Translation
 - UNI5538 - - UNI10120 - - UNI15043 - MGSGPIDPKELLKGLDSFLTRDGEVKSVDGISKIFS - UNI5538 - - UNI18339 -

 SLMKEARKMVSRCTYLNIILQTRAPEVLVK - UNI1370 - KFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQ NNTAKLVKQ

LSKSSEDEE - UNI359 - ELRKLASVLVSDWMAVIRSQSSTQPAE EKDKKKRKEEGKSRTTLPERPLTEVKAETRAEEAPEKKKEKPKSLRTTAPS

HAKFRSTG GLELDTPSLVPVKKNSSTVVVSDKYNLKPIPLKRQS SATAAPGDAAPPAEKKYKPLNTAPNTTKEIKVKIIPPQP PMEGLGFLDALNSA

PVPGIKIKKKKKVLSPTAAK PSPFEGKTSTEQSTAKPSSPEPAPPAEPMDTDRPGTPVPPVEVPELMDAA ASSEPGALDAKPVDSPGDPNQLTRKGRK

RKTVTWPEEGKLREYFYFELDETERV VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVIPGSNSQERYIQAEREKGI

LQELFLNKES SPHEPDPEPYEPIPPKLIPLDE ECAMDETPYVETLEPGGSGGSPDGAGGSKLPPVLANLMGSMGAGKSPQGPGGGGINVQEILTSIM 

GSPNSHPSEELLKQPDYSDKLKQMLV VPHGLLGPGPVANGFPPGGPGGPKGMQHFPPGPGGPMPG GPHGGPGGPVGPRLLGPPPPSRGGDPFWDGPGD

PMRGGPMRGGPGPAPGPYHRGRGGRGGNEPPPPPPFRGARGGRSGGGPPNGRGGPGGGGMVGGGGHRPHEGPGG GNMGSGHRSHDGPGGNMGGSGGHRS

HEGPGHGGPHGHRPHDVPSHRGHDHRGPPPHEHRGHDGHGGGGHRGHDGGHSHGGD DMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP

For any suggestions or comments, please send an email to unitrap@crg.es