Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039230 (Tbcd)
Chromosomal location
Chr 11: 121313261 - 121478477 (+)
Description
tubulin-specific chaperone d Gene [Source:MGI (curated);Acc:Tbcd-001]
RefSeq_dna
NM_029878 
RefSeq_peptide
NP_084154.1 
MGI
MGI:1919686 
Uniprot/SWISSPROT
Q8BYA0 
Uniprot/SPTREMBL
A2AAV4 Q8CHC0 Q8R199 B1ATU0 
Human Ortholog
ENSG00000141556 (TBCD)
Omim not available
UniTrap UNI34353
Vector Insertion
Chr 11: 121313543 - 121314944
Public Clones IST10874F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12259
Vector Insertion
Chr 11: 121358308 - 121358366
Public Clones A051D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6207
Vector Insertion
Chr 11: 121358452 - 121360349
Public Clones CSG264 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5179
Vector Insertion
Chr 11: 121365006 - 121365102
Public Clones CSH344 (baygenomics) YTC117 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33074
Vector Insertion
Chr 11: 121365102 - 121402165
Public Clones IST10985G10 (tigm) IST13000H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16309
Vector Insertion
Chr 11: 121402165 - 121402323
Public Clones not available
Private Clones OST463459 (lexicon) OST58569 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4283
Vector Insertion
Chr 11: 121402323 - 121411537
Public Clones AH0287 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13348
Vector Insertion
Chr 11: 121418300 - 121421988
Public Clones CMHD-GT_329H4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34779
Vector Insertion
Chr 11: 121422075 - 121435109
Public Clones IST11961E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34581
Vector Insertion
Chr 11: 121435191 - 121436599
Public Clones IST10500B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000103013
Sequence
TTGGGGGTCGAAGGTCTCAGGGCGGGGCTGGCAGTTCTCGTGCTGTATCTCTTTTCTTCCCGGTTGCCGGTAGGGTTCTTACGGAAGCTGCTGGCAGGAT

GGTACTGAGCAATGAGCCGGCTGCGAGCGCCGCCGAGGAGGAGGTGGAGGATGATGCGCTTGTTCGCGCCTCCGCCCTGGAAGCGTTCGGCGAGAGTGCG

GAGACCCGCGCGCTGCTCCGCAGCTTGCCGGCGGTGCACAGAGAGCGCGCGTCCCGGGAGGTGGCGGAGGAGCGGTTCCGCG - UNI34353 - TAAT

TATGGACAAATACCAGGAGCAGCCCCACCTCCTGGATCCACACCTTG AGTGGATGATGAACTCACTGTTGGACCTGGTACAGGATGAGACATCTCTGCC

CGACCTTGTCCATCTGGCTTTTAAGTTTCTTTATATCATCACCAAG GTTCGTGGATATAAAGTGTTTCTGCGTCTGTTTCCTCACGAAGTGGCTAATGT

TCAGCCTGTGTTAGATATGTTCACAGGTCAGAACCCTAAAGACCATGAG ACGTGGGAAACACGCTACATGCTTCTACTGTGGCTCTCTGTGACCTGCTT

GATCCCTTTTGATTTTTCACGCCTTGATGGGAACCTGTCTACTCAAACTGGAGAAACACGAGTACCCACCATGGACCGAATTCTGCAAATAGCAGAG TC

TTACTTGGTGGTCAGTGACAAGGCGCGAGATGCAGCTGCTGTCCTTGTGTCCAA ATTTATCACACGTCCCGATGTCAAGCAGAGAAAGATGGCCAGCTT

TCTGGACTGGAGCCTTTGCACCTTGGCCCACTCTTCCTTCCAGACCATCGAGGGTGTCATTACCATGGATGGGATGCTGCAGGCCCTG GCTCAAATATT

TAAGCATGGAAAACGTGAAGACTGCCTTCCCTATG CCAACACTGTGCTCCAGTGCCTCGACGGCTGCAGACTCCCCGAGAGCAGTCATACCTCGCTGCG

GAAGCTTGGTGTGAAGCTTGTCCAGAGGCTGGGGCTGACTTTCCTGAAGCCAAAGGTGGCCACGTGGAG - UNI12259 - GTATCAGCGTGGCTGTC

GGTCTTTGGCTGCTAACCTGAAGCTCTGTGCCCCGGGTAAGAGTGACCAGAAGCTGCTGTCTGATAGTTTGACCTCTGATGGTGATGAAGACTATGATGT

CCCAGAGGGGGTAGAAACTGTGATAG - UNI6207 - AGCAGCTACTGGTTGGGTTGAAGGACAAGGACACTGTGGTGCGGTGGTCTGCAGCGAAAGG

 AATTGGTAGGATGGCTGGAAGGCTTCCCAGAGAGCTGGCCGATGATGTGGTGGGGTCTGTGTTGGACTGTTTCAG - UNI5179 - TTTTCAGGAGA

CGGATAAGGCATGGCATGGTGGATGTCTGGCATTGGCAGAGCTGGGTAGACGAGGCCTGTTGCTACCATCCAGACTCTCAGAGG - UNI5179 - - U

NI16309 - - UNI33074 - TTGTCACGGTGATCCTGAAGGCCCTTACCTACGATGAGAAGCGGGGTGCCTGCAGCGTTGGGGCCAATGTCAGGGAT

GCTGCCTGTTATGTGTGCTGGGCTTTTGCACGTGCCTATGAACCTCAGGAGTTGACACCTTTTGTGACTGCCATTTCAAG - UNI4283 - - UNI16

309 - TGCCCTGGTCATTGCTGCTGTATTTGACCGAAATGTGAACTGCAGAAGAGCAGCCTCT GCTGCCTTCCAGGAGAACGTGGGGAGACAG - UN

I13348 - GGTACTTTCCCTCATGGAATTGATATTTTGACTACAGCAGACTATTTTGCAGTTGGTAACATATCTAACTGTTTCCTGATTATAAG - UN

I34779 - TGTGTTTATTGCTGGCTTCCAGGAATACACCAAGCCCATGATTGATCACCTGGTCTCCATGAAAATCAACCATTGGGATGG - UNI3458

1 - GGCCATCCGAGAACTGTCTGCAAAGGCATTGCACAACCTGACTCCACAAGTACCCGAGTACATAGCCATGCACG TATTCCCTGCACTACTGTTGA

TGACACAGAGTCCAGATCTACACACGAGACATGGTGCCATCCTTGCCTGTGCAGAGGTCACCTATGCCCTGTACAAGCTGGCCACACAGAGTAACAG GC

TTGTCACAGACTATCTGGATGAGAAGGCAGTGCAAAGCCTGAAGCAGATCCACCAGCAG CTTTGTGACCGCCATCTCTATAG GGGTCTTGGAGGAGAG

CTTATGAGACAAGCAG TGTGCATCTTAATAGAGAAGCTGTCACTTTCCAGAATGCCATTTAAAGGGGACGCCACTGTCG AAGGTTGGCAGTGGCTGAT

AAATGACACTCTCAGGAGTCTTCACCTTGTTTCAAGCCATTCCAGACAACAGATCAAG GAGGTGGCTGTCTCTGCCCTGACTGCCCTCTGCAGTGAATA

CTACGTGAAGGAGCCTGGGGAGGCAGGCTCCTCCATCGCGA AGGAGCTGATTCCCCAGTACCTTGCTGAGCTCCAGAGCCCAGAGGAGATGGCCCGTTG

TGGCTTTTCCTCAGCCTTGGGTGCCCTCCCAGGTTTCCTTCTCAGGGGCCATCTGCAGCAG GTTCTCTCAGGTCTGAGAAGAGTCACCTGTATTTCTCC

CAATGATGTGAGCTTTGCTGAAGCCCGGAGAGATGGTTTGAAAGCAATCTCAAG AATTTGCCAGACGGTTGGTGTGAACACACGGGGGCCTCCAGATGA

AGTCATATGCAAAGAGAACATCTCTGAGGTTTATGCTGCATTGCTGGGCTGCATGAGTGATTACACCACAGACAGCAGAGGGGATGTGGGAGCCTG GGT

TCGTGAGGCTGCCATGACCAGCCTCATGGATTTGATGCTTTTGCTGGCACGGACAGAGCCGGTGCTGATTGAGGCCCACAT CTGTGAGCGCGTCATGTG

TTGCGTTGCCCAGCAAGCAAGTGAGAAGATTGATCGGTTCCGTGCTCATGCTGCCCGGGTGTTCCTGACTCTCTTGCACTTCGACAGCCCTCCCATTCCC

CATGTTCCCCACCGCCAAGAACTGGAAAGTCTGTTTCCCAG GTCTGATGTGGCCACTGTGAACTGGAACGCACCTTCCCAGGCCTTCCCTCTCATCACC

CAGCTCTTGGGATTGCCTACCTATAGATACCATGTCCTGCTGGGGCTGGCTGTGTCTGTGGGTGGCTTGACAGAGTCTACG GTCAGACATTCTACACAG

AGCCTCTTTGAGTACATGAAGGGGATTCAGAAGGATGCTCAGGTCCTGCAGAGCTTCAGTGAGACCCTCCTGAAGGTCTTTGAGGACAACCTTTTGAATG

ATAG GGTGTCTGTATCACTGCTGAAAATGCTGGACCAGCTGTTGGCTAATGGGTGCTTTGACATCTTTACTGCCGAGGAGAA CCACCCCTTTTGTGTG

AAGTTGCTCACACTTTGTAAGGAAGAAATCAAGAAGTCAAAAGACATCCAGAAACTTCGGTCAAGCATCGCAGT GCTCTGTGGGATGGTGCAGTTCAAT

GGTGATGTGAGAAAGAAGATTCTTCTTCAGCTGTTCCTCCTCCTCGGCCACCCTTTCCCTGTG ATCCGGAAGAGCACAGCGAGCCAGGTCTACGAGATG

GTGCTTACCTACAGCGACCTGGTAGATGCCGAGGTGCTTGATGAGGTCATGTCTGTGCTCAGTGACACAGCCTG GGACGCAGAGCTTCCAGTTGTAAGA

GAACAGCGGAATCGCCTGTGTGACCTTCTTGGCGTGCCCAGACCCCAGCTGGTTCCAAAG CCTATTCCAGGAAGCTGAGCCTTGCCTACCTAGCTGGGA

TGTCTCGCCCTGAGGCTCCACAACAAGCTTTACCATCATGGAAACTTGGTGCCACAGACATCTGAGGAAGGTAGCACCTTCATTGGGAGGCCATCCCTGG

AGAGCAGTAATTCCTCATGCGTGCTTTGCTCTGGTGGCCGGGACTGCCCATACGTTTGCTGTCACAGACGTGCTTCTCATTAAATCATGTATCACAC
Translation
MVLSNEPAASAAEEEVEDDALVRASALEAFGESAETRALLRSLPAVHRERASREVAEERFRV - UNI34353 - VIMDKYQEQPHLLDPHLE EWMMN

SLLDLVQDETSLPDLVHLAFKFLYIITK VRGYKVFLRLFPHEVANVQPVLDMFTGQNPKDHE TWETRYMLLLWLSVTCLIPFDFSRLDGNLSTQTGET

RVPTMDRILQIAE SYLVVSDKARDAAAVLVSK KFITRPDVKQRKMASFLDWSLCTLAHSSFQTIEGVITMDGMLQAL AQIFKHGKREDCLPYA ANT

VLQCLDGCRLPESSHTSLRKLGVKLVQRLGLTFLKPKVATWR - UNI12259 - RYQRGCRSLAANLKLCAPGKSDQKLLSDSLTSDGDEDYDVPEGV

ETVIE - UNI6207 - EQLLVGLKDKDTVVRWSAAKG GIGRMAGRLPRELADDVVGSVLDCFS - UNI5179 - SFQETDKAWHGGCLALAELGR

RGLLLPSRLSEV - UNI5179 - - UNI16309 - - UNI33074 - VVTVILKALTYDEKRGACSVGANVRDAACYVCWAFARAYEPQELTPFVT

AISS - UNI4283 - - UNI16309 - SALVIAAVFDRNVNCRRAAS AAFQENVGRQ - UNI13348 - GTFPHGIDILTTADYFAVGNISNCF

LIIS - UNI34779 - SVFIAGFQEYTKPMIDHLVSMKINHWDG - UNI34581 - GAIRELSAKALHNLTPQVPEYIAMHV VFPALLLMTQSPD

LHTRHGAILACAEVTYALYKLATQSNR RLVTDYLDEKAVQSLKQIHQQ LCDRHLYR RGLGGELMRQAV VCILIEKLSLSRMPFKGDATVE EGWQW

LINDTLRSLHLVSSHSRQQIK EVAVSALTALCSEYYVKEPGEAGSSIAK KELIPQYLAELQSPEEMARCGFSSALGALPGFLLRGHLQQ VLSGLRRV

TCISPNDVSFAEARRDGLKAISR RICQTVGVNTRGPPDEVICKENISEVYAALLGCMSDYTTDSRGDVGAW WVREAAMTSLMDLMLLLARTEPVLIEA

HI ICERVMCCVAQQASEKIDRFRAHAARVFLTLLHFDSPPIPHVPHRQELESLFPR RSDVATVNWNAPSQAFPLITQLLGLPTYRYHVLLGLAVSVGG

LTEST VRHSTQSLFEYMKGIQKDAQVLQSFSETLLKVFEDNLLNDR RVSVSLLKMLDQLLANGCFDIFTAEEN NHPFCVKLLTLCKEEIKKSKDIQK

LRSSIAV VLCGMVQFNGDVRKKILLQLFLLLGHPFPV IRKSTASQVYEMVLTYSDLVDAEVLDEVMSVLSDTAW WDAELPVVREQRNRLCDLLGVPR

PQLVPK PIPGS
Transcript ENSMUST00000106093
Sequence
AGTTGGAATCTGTGGCCTTGCTTAGCAACACCTTTGTCTCTGGATTCCTGCAAGAGGGACCTGGAACTTTTGTTTTTCCTGTCACCTGCCCTTACCCACT

TATTCTGCCTTACCATGATGTTGCACACTGTG GCTCAAATATTTAAGCATGGAAAACGTGAAGACTGCCTTCCCTATG CCAACACTGTGCTCCAGTGC

CTCGACGGCTGCAGACTCCCCGAGAGCAGTCATACCTCGCTGCGGAAGCTTGGTGTGAAGCTTGTCCAGAGGCTGGGGCTGACTTTCCTGAAGCCAAAGG

TGGCCACGTGGAG - UNI12259 - GTATCAGCGTGGCTGTCGGTCTTTGGCTGCTAACCTGAAGCTCTGTGCCCCGGGTAA
Translation
MMLHTV AQIFKHGKREDCLPYA ANTVLQCLDGCRLPESSHTSLRKLGVKLVQRLGLTFLKPKVATWR - UNI12259 - RYQRGCRSLAANLKLCA

PG
Transcript ENSMUST00000036990
Sequence
ATGATGTTGCACACTGTG GCTCAAATATTTAAGCATGGAAAACGTGAAGACTGCCTTCCCTATG CCAACACTGTGCTCCAGTGCCTCGACGGCTGCAG

ACTCCCCGAGAGCAGTCATACCTCGCTGCGGAAGCTTGGTGTGAAGCTTGTCCAGAGGCTGGGGCTGACTTTCCTGAAGCCAAAGGTGGCCACGTGGAG 

- UNI12259 - GTATCAGCGTGGCTGTCGGTCTTTGGCTGCTAACCTGAAGCTCTGTGCCCCGGGTAAGAGTGACCAGAAGCTGCTGTCTGATAGTTT

GACCTCTGATGGTGATGAAGACTATGATGTCCCAGAGGGGGTAGAAACTGTGATAG - UNI6207 - AGCAGCTACTGGTTGGGTTGAAGGACAAGGA

CACTGTGGTGCGGTGGTCTGCAGCGAAAGG AATTGGTAGGATGGCTGGAAGGCTTCCCAGAGAGCTGGCCGATGATGTGGTGGGGTCTGTGTTGGACTG

TTTCAG - UNI5179 - TTTTCAGGAGACGGATAAGGCATGGCATGGTGGATGTCTGGCATTGGCAGAGCTGGGTAGACGAGGCCTGTTGCTACCATC

CAGACTCTCAGAGG - UNI5179 - - UNI16309 - - UNI33074 - TTGTCACGGTGATCCTGAAGGCCCTTACCTACGATGAGAAGCGGGGT

GCCTGCAGCGTTGGGGCCAATGTCAGGGATGCTGCCTGTTATGTGTGCTGGGCTTTTGCACGTGCCTATGAACCTCAGGAGTTGACACCTTTTGTGACTG

CCATTTCAAG - UNI4283 - - UNI16309 - TGCCCTGGTCATTGCTGCTGTATTTGACCGAAATGTGAACTGCAGAAGA
Translation
MMLHTV AQIFKHGKREDCLPYA ANTVLQCLDGCRLPESSHTSLRKLGVKLVQRLGLTFLKPKVATWR - UNI12259 - RYQRGCRSLAANLKLCA

PG - UNI6207 -   - UNI5179 -  - UNI5179 - - UNI16309 - - UNI33074 -  - UNI4283 - - UNI16309 - 

For any suggestions or comments, please send an email to unitrap@crg.es