Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039285 (Azi2)
Chromosomal location
Chr 9: 117949617 - 117973025 (+)
Description
5-azacytidine induced gene 2 Gene [Source:MGI Symbol;Acc:MGI:1351332]
RefSeq_dna
NM_013727 
RefSeq_peptide
NP_001041611.1 NP_038755.1 
UniGene
Mm.92705 Mm.387529 Mm.474919 
MGI
MGI:1351332 
Uniprot/SWISSPROT
Q9QYP6 
Human Ortholog
ENSG00000163512 (AZI2)
Omim not available
UniTrap UNI18714
Vector Insertion
Chr 9: 117950077 - 117956530
Public Clones not available
Private Clones OST416499 (lexicon) OST332119 (lexicon) OST82843 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6213
Vector Insertion
Chr 9: 117958554 - 117959014
Public Clones CSG297 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33911
Vector Insertion
Chr 9: 117965029 - 117968174
Public Clones IST14158D6 (tigm) IST12535D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044454
Sequence
ACCCTATATAGTCTTCAGGTCCGGCTTCCGGTTTCGTCGCGCTGCGCTGGCACCCAGCCTGTGCGCAGCGGCGACACCTTTGTGGGCGGCGGGGCGTTCG

TAGACCCTTCTAGAACCCTCTAGGCCTCGCCGCCCCTGAGCGGGGCAGCGGGCGCCGGCGACCCCGGAGTTGACGCGCGTGCTGCTGGGTAACGGGCCTG

TTCCGGCGGCCCCGGGCCGCCCCTGCTCGGTTCCTCTGTGACCTCCAGGGCCCCTGACTGCGGGAGCCGCGGCGGAAGACATGGGACTCCCTCGGTGCAC

CTGTGACGGCCACCTTGACGGGGGAAGCGGTGGCGTCTTCGAGGAAACCGGAAGCCCGTGGTGACCCCTGGCGACCCGGTTTGTTTTCAGCCGGCTTCCA

AACACTGGGGAAGCGAAACCCGGTGGCCTTGGGGACCGCCCTACGTAGCCAGGGTTCAGG - UNI18714 - CTGCCATGGACACGCTAGTAGAAGAT

GACATCTGCATTCTGAATCATGAAAAGGCCCACAGGAGAGAGGCAGTGACTCCACTCTCAGCGTACCCTGGAGATGAGTCTGTTGCTTCCCATTTCGCAC

TGGTCACTGCTTATGAAGACATCAAAAAGAGGCTGAAGGATTCAGAGAAAGAAAACTCCTTCTTAAAGAAAAGAATCAGGGCTTTGGAAGAAAGG CTTG

TTGGAGCTCGAGCAGATGAAGAAACAAGTTCTGTGGGCCGAGAACAAGTGAATAAGGCCTATCATGCATATCGTGAGGTTTGCATTGATAGAGACAATCT

GAAGAACCAATTGGAAAAGATA - UNI6213 - AATAAAGACAACTCTGAATCTTTGAAAATGTTGAATGAGCAGCTACAGTCTAAAGAAGTAGAACT

TCTGCAGCTAAGAACAGAGGTGGAGACTCAGCAGG TGATGAGGAATTTAAACCCACCCTCATCCAGCTGGGAGGTGGAGAAGCTAAGCTGTGACTTGAA

GATCCATGGTTTGGAGCAAGAGCTGGGACTACTGAGGAAGGAGTGCAGTGACCTCAGGACAGAGCTGCAGAAGGCCAGACAGACG GGTCCACCTCAGGA

AGACATTCTGCAGGGCAGAGATGTCATCAGGCCGAGCTTGTCGAGAGAAGAGCATGTTCCACACCAGGGTCTTCACCACAG - UNI33911 - TGATA

ATATGCAACATGCATACTGGGAACTGAAGAGGGAGATGTCTAACTTACACCTGGTGACTCAAGTGCAAGCAGAACTACTAAGAAAACTGAAAACCTCAGC

TGCAGTCAAGAAAG CCTGTACCCCAGTAGGATGTGTTGAAGACCTTGGGAGAGACAGCACGAAATTGCACTTGACAAATTTTACTGCAACTTACAAAAG

ACATCCCTCTTTGTCACCAAATGGCAAAGCTCCTTGTTATGCTCCGTCTTCCCCTTTACCAGGAGATAGAAAGGTTTTCTCAGACAAAGCAGTTCTTCAG

TCATGGACAGATAACGAGAGATTGGTTCCTAATGACGGTGCAGACTTTCCAGAGCACAGCTCCTATGGGAGAAATTCTCTGGAAGATAATTCCTGGGTAT

TCCCAAGCCCTCCTAAATCAAGTGAGACAGCATTTGGTGAAAATAAAAGCAAAATCTTACCTTTATCCAACCTGCCGCCACTGCATTACCTGGATCAACA

GAATCAGAACTGCCTTTACAAAAGTTAATTTCACTTGTGATTTGATCAGGAAGACACGGACTCAGGGGTTCTCCCAAGAGATTGTTCAAACTGAAAGTGG

ACTTTGATTGATGGCTTGTGCAGTTCTCCAGTATGTACATTTGTACATTCTGTATAACATTATATATGTAATTGATTTTCCAGTATGGGAACCTCCAGTT

GTACCTTTGATAACAATTATACATTTTTGCTTCTTGGATAGAGTGGAAATGAAAATTTTAGGCATGGTTTTATAAAGTATGTGACCTGCCTAAATATCCA

ATCATTAAATAAAAAGCAGCCTTTAGTATAAAAGAAAAAACATGTCTGCTGGTTTAGATTGTATCAAGAAGCAAGTAAGAGTAGGTTGAGCTTCTGTAAA

TTCCTGATACATAAAGATTTGAAATATAATGGAATAAAAGTAGGTTATGACATCTCTATGCTATTGTTTCAAGTTTTAAGATTTAAAATCATTTTTAAGT

AAAATGTTTGTATATACAAATTTAAAGTGCAATTTGAATTCTAAGACTTGAATTAATGACTATTGAAGCCAACTTTTTCCCAGTATATTTAAATCCTAAA

TAGTTAAAAATGATGTGGTATGTGAATAAACTATTATAACCTTATACAATGTCCAGTTAAAAGAAGAAAGAGCATCTCACAGGGCAGTCTCTTCAGTGAT

GTGTAGTGAACCTCCCGTGTGGTCATTTTCAGCAGGACAGCTATTTGTTTTACACAGAGCAGCTTACACACTGTTAGATATGACATTTGAGAAAGTAAAT

GCTAATTAGCTGCATCTAGAACTAAATCTTGTGCTGTACAATTGTGAAATATCCCAACTCATTCTAAGTGCCCAATCACTTGTAAATAAGTAAAGAAATA

ACAAAGATGGCTTCATGTGGAAATTCATCTAAATTTTTTCAAGGTGGAAGCATTAAGAGTATTAGTAATCATGTATTACCTGTTTGATGTAAGAAGACTT

TATCCTTTTCTAAGTGCCATTTCATGTATCTTGAATTCAGAGGATCTCTGACCTTGTATCACTGAATAGAATGCATAGCCAGGCACTGTTCACTGTTGAG

TTATCTCAGTCACTTACTCATGCCTGTCCGTGATTAATGGAATTGATGTCAGATACTGGAATGTGTTCTGACCAATGAACACAGCTGACTCGAGGGAGTA

CAGGCTCCTGCCAAGTAATACAACAAGACCCAATATGCATAAAACAAATACACAAGCCCAGGCTCTAGCTGAAGGCACTAACTGACTGTGTAATAAGAAA

GCAAACGCAGTTCTCGTGTGACTGCGGAGGCTGTCCATCATCTTAGGACTGATGTAGCTTAATGGTTTGCTTTTTTTCAAACCAAGATGAGAAGTTTTCT

TTTGTAAAGAGAGTCTTATAATGTTTTTGAACAATGCCAAGAAATTGTTTTAATTAAAATTATTTTTGTTTTTAAAATGGAATTGGATGTGAAATACTGT

CCTTGCCTATGTATATTTCCAAAGTCTGGTATTAATTTTATTTCTCCAACATACTCTGAATGGAGGGAATCCCCTCTAACTAGTAGTAACCGTTATCAAA

AAGGATTGCTAGAACAGTCTGATGGGTGTTAACAGTCAAAGTGTTAAAAGCTTGTGTAAGACTCCTTAGCTAGAAAAGAGAAACCCTAAAATATTCTTAC

CTGGTCAGAAAATGTTTAAATATATACTTAGTCAATGGTAACAGCTGTATTTTGTGATTCATTAAAATTGACAGTCCCGTTGGTCCTTTTCATACTAGCT

GACAACCCC
Translation
 - UNI18714 - MDTLVEDDICILNHEKAHRREAVTPLSAYPGDESVASHFALVTAYEDIKKRLKDSEKENSFLKKRIRALEER LVGARADEETSSV

GREQVNKAYHAYREVCIDRDNLKNQLEKI - UNI6213 - NKDNSESLKMLNEQLQSKEVELLQLRTEVETQQV VMRNLNPPSSSWEVEKLSCDLKI

HGLEQELGLLRKECSDLRTELQKARQT GPPQEDILQGRDVIRPSLSREEHVPHQGLHHS - UNI33911 - SDNMQHAYWELKREMSNLHLVTQVQA

ELLRKLKTSAAVKKA ACTPVGCVEDLGRDSTKLHLTNFTATYKRHPSLSPNGKAPCYAPSSPLPGDRKVFSDKAVLQSWTDNERLVPNDGADFPEHSSY

GRNSLEDNSWVFPSPPKSSETAFGENKSKILPLSNLPPLHYLDQQNQNCLYKS

For any suggestions or comments, please send an email to unitrap@crg.es