Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039298 (Cdk5rap2)
Chromosomal location
Chr 4: 69884058 - 70071401 (-)
Description
CDK5 regulatory subunit associated protein 2 Gene [Source:MGI (curated);Acc:Cdk5rap2-001]
RefSeq_dna
NM_145990 
RefSeq_peptide
NP_666102.2 
UniGene
Mm.379344 
MGI
MGI:2384875 
Uniprot/SWISSPROT
Q8K389 
Uniprot/SPTREMBL
Q5SP74 Q5SP75 A2AVA1 Q0VGR5 Q2TBE5 Q9CUY5 
Human Ortholog
ENSG00000136861 (CDK5RAP2)
Omim 604804 - MICROCEPHALY, PRIMARY AUTOSOMAL RECESSIVE, 3  
UniTrap UNI36911
Vector Insertion
Chr 4: 70064507 - 70071402
Public Clones 5SE307B10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI859
Vector Insertion
Chr 4: 70062347 - 70064507
Public Clones CB0269 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1571
Vector Insertion
Chr 4: 70062278 - 70062347
Public Clones CC0120 (sanger) RRU031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2844
Vector Insertion
Chr 4: 70037826 - 70037904
Public Clones BA0008 (sanger) AF0651 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31325
Vector Insertion
Chr 4: 70025040 - 70037904
Public Clones IST14819F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20390
Vector Insertion
Chr 4: 70015746 - 70015910
Public Clones not available
Private Clones OST364713 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8075
Vector Insertion
Chr 4: 69998594 - 70010177
Public Clones RRO242 (baygenomics) RRF465 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7845
Vector Insertion
Chr 4: 69978632 - 69998374
Public Clones RRP078 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8854
Vector Insertion
Chr 4: 69952962 - 69959853
Public Clones XM173 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6710
Vector Insertion
Chr 4: 69933810 - 69937507
Public Clones HMA561 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9718
Vector Insertion
Chr 4: 69915849 - 69918368
Public Clones XG271 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9710
Vector Insertion
Chr 4: 69911507 - 69915669
Public Clones XG188 (baygenomics) A035C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098013
Sequence
GAGGAAGAGATGACATTTTCAAGTTTGCACCAAGTACGATATGTGAAGCATATGAAAATCCTCCGTCCACTAACCCCGGAGATGATTGATGGCAAGATGC

TAGAGAGCCTCAAGCAGCAGCTGGTGGACCAGGAGCAGGAGCTACAGAAGGAGCAGGACTTGAACTTGGAACTTTTCGGTGAAATCCATGACCTGCAGAA

CAAGTTCCAAGACCTCTCGCCATCAAG ATACGATTCATTGGTTCAGTCCCAAGCGAGGGAGCTCTCCCTTCAGCGACAGCAAATTAAGGATAGCCATGG

CATCTGTGTCATTTACCGTCAACACATGAGCACCATGATCAAGGCGTTTGAGGAGCTTCTGCAGGCCAGTGATGTGGACAGTTGCGTGGCCGAGGGCTTC

CGGGAGCAGCTGACACAGTGTGCTGGACTGCTAGAGCAACTGGAGAGGCTGTTTCTCCATG GAAAATCAGCCAGAGTGGAACCACATCCCCAGAATGAA

CTGCTCAAGGG - UNI9718 - GTTAAGGACTGTGGAAGGCAACTTACCCTACCACCATCTCCTGCCTGAATCTCCTGAGCCTTCTGCCTCCCATGCT

CTGTCAGATGATGAAATGTCTGAGAAGTCCTTCCTGTCTAGAGACCCGAAGCCAGACAGCGATACTGAGAAGTACCCAGCAATGGCGAGCCATTTTCCTC

AAG - UNI9710 - ACTTACTAATGGAACACATACAGGAAATTCGAACTTTGAGAAAGCATTTGGAAGAATCTATTAAAACAAATGAGAAGCTCCGGA

AACAGCTGGAACGGCAGGGGTCTGAGACTGACCAAG GGAATTTGATTAATCTGAGTTCTTATGCCAAACATGAGAAAGAAATACATGCCTAG
Translation
 MIKAFEELLQASDVDSCVAEGFREQLTQCAGLLEQLERLFLHG GKSARVEPHPQNELLKG - UNI9718 - GLRTVEGNLPYHHLLPESPEPSASH

ALSDDEMSEKSFLSRDPKPDSDTEKYPAMASHFPQD - UNI9710 - DLLMEHIQEIRTLRKHLEESIKTNEKLRKQLERQGSETDQG GNLINLSSY

AKHEKEIHA
Transcript ENSMUST00000084491
Sequence
GTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCCGGGGAACCAGTGGCGCTGCCGCCGCCGACACCGGCGCCACCACTCTGCGTTCACG

ATGGACTCGGGGATGGAAGAGGAAGGCGCCCTGCCTGGGACCCTCAGCGGTTGCAG - UNI36911 - TGGCCTTCACCCTGTTCTGCCAAGTGACCT

GGATGTCATCAGTGACACTTCTGGCTTGGGAAATGGAG - UNI859 - - UNI1571 - - UNI36911 - TGCTCCCAAGCATGTCAGAAGAAAA

GGTTTCTCCCACCAGAGCCCGGAACATGAAGGACTTTGAAAAC - UNI1571 - CAAATCACTGAGCTGAAGAAGGAGAACTTCAATCTAAAGCTCCG

GATCTACTTCCTGGAGGAGAGAATCCAGCAGGAGTTTGCTGGCCCCACCGAGCACATCTACAAGACG - UNI2844 - - UNI31325 - AACATTG

AACTCAAGGTGGAAGTGGAAAGTCTGAAGCGCGAGCTCCAGGAGAAAGATCAGTTGCTCGTCAAAGCCTC - UNI2844 - - UNI31325 - CAAA

GCGGTGGAGAGCCTAGCAGAACGGGGTGGTTCTGAAGTCCAGCGGGTGAAAGAAGATGCAAGGAAGAAGGTGCAGCAGGTGGAAGACCTCCTAACGAAAA

GGATACATCTTCTAGAAGAA - UNI31325 - GATGTGAAAGCCGCCCAGGCAGAACTGGAGAAGGCCTTTGCGGGGACAGAAACAGAGAAGGCTCTT

CGGCTCAGCTTAGAAAGCAAGCTCTCGGCGATGAAGAAGATGCAGGAGGGGGACCTGGAGATGACTCTGGCTCTGGAAGAGAAGGACAG - UNI20390

 - ACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTTAAAGAGGAAAAATCTCAGATGGCATCTCCTGACGAGAAC

GTGTCATCTGGAGAACTCCGAGGACTTTCTGCCACTCTGAGGGAAGAAAAAGAGAGAGACGCTGAG - UNI20390 - GAATGGCAGAAGGAGAGAAA

CCACTTTGAAGAGAGGATCCAG GCACTTCAGGAGGACCTGAGAGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAACTTAAAGAGTTATAAAGC

CATTCAGGGTCTAACCATGGCATTAAAATCAAAGGAAAGAGAG GTTGAAGAACTTGATTCCAAAATCAAAGAGGTCACTACGGACTCCACCAAAGGCAG

AGAGGATCCCTTAAAAACCCAGATCCCCAGATTCCAGCTAAGAGAG - UNI8075 - GGGTCTGAGGACTGTGAAGCTGCGCTGGTAGAGAAGGAAGC

CCTATTGGCCAAGCTACACTCAGAAAATGTCACAAAGAGCACTGAGAACCATAGGTTGCTCAGGAATGTTAAAAAGGTCACCCAGGAGTTGAATGACTTG

AAGAAGGAGAAGTTGAGACTAGAGCAGGCCCTGGAGGAAGCCCACCAAGAGGGGAACAGAGGAGCCCGAACCATTCAC - UNI7845 - GACCTTAGA

AATGAAGTTGAGAAACTACGCAAGGAAGTGAGTGAGAGAGAGAAGGCTGTGGAAAAACATTACAAGAGTCTTCCAGGTGAAAGCAAGACAAAGTTTCATA

CTCAAGAACAAGTGGTCAGAAGTCTGACAGGCAGTGGCAGTCAGGAGGACCTGCTGCTTCAG AAATCCAATGAAAAAGATTTGGAAGCAATACAGCAGA

ACTGCTATTTAATGACTGCAGAGGAGCTCAAGTTTGGGAGCGATGGCTTAATAACAGAAAAGTGTTCTCAGCAGTCACCAGACAGCAAACTCATCTTCTC

CAAG GAAAAGCAACAATCAGAGTATGAAGGGCTGACTGGGGACTTAAAAGCAGAACAGAACATCTATGCCCATCTGGCAAAGACTCAGGACACAGACAG

 TGTCAGCAACCTGCAGGCTGAGCTGAAAGAGGTCCTTGCCCTTCGGAAGCAGCTGGAGCAGGATGTTCTTGCCTACCGGAACCTGCAGAAGGCCCTGCA

GGAGCAGCTCAGTGAGATTCGGAGTCGAGAAG AAGAGCCGTTTTCATTTTATAGCGATCAAACATCGTATCTGAGTATTTGCCTTGAAGAGCACAATCA

GTTCCAATTGGAGCATTTTTCTCAAGAAGAACTCAAGAAAAAG GTCAGTGACCTCATACAGCTTGTGAAGGACCTGCACACAGACAACCAGCACCTGAA

GAAAACCATTTTTGATCTCTCTTCTGTGGGTTTCCAGGGAAGTGACAGACTTGAGTTAACAAAACAAGAAGAG - UNI8854 - CTTGTGGCTAGCAA

GGAGGATGAGGACACACTCAAATTTGAAGCGGACGTTGAGACTCCTTTCCAGAGTGACCAGCATTTGGAGCAAAGTCGTGAG ATCATGGAGGACTATGC

TGAGGGTGGCTGCAAAAGTGGATATGGAAGGCACATGGATTCCAATATTTTAGGTCATGATGGGGCCCAAACTCCTGGTGCCTCTGAAGAGCACACCCTA

GAAGATGAGCTCCTGGGCCTGCTTGCCACTCTCTTCAGTAAGAAGGCCACACCGTTGCTGGAATCCAG GCCAGATCTTCTGAAAGCACTCGGTGCCCTA

CTTTTGGAACGCATATGCTTGGCAGAGCAGGGTCGTCCTGGAGATCACCTTGATAGTAAAACTGAGAAGGCACTTCAGCAAGTAGCTGTTCAGTTGAGAG

ATGAACTTGGCCATTCCTTCCCTGCCAACTCGTTCTCCAAGTCATACAATGAAGTCAAGTCAATGTGGGGAAATTGGCTGGTAAAGACAGGAGACGAAGA

CACGGTGGAGCTGAAGAGTGTTTCAGTGCAGACCATGGCCATAGAGGACACCCCGCATGGATTCAAACCTCAAAGCAAGAGAGATGCTTGGGCAGAGAAA

CAAGAAGAGGCCATTTTCAGCACTGAGCTTGAGTCAGAGGCGTTGGGTGAGATGCCAGGGCAACAGGCCACTCACCTCTCATTCCCCAGTGCCATCAACC

CG GATGCCGAGAAGACGGGCTTGTTGATCCAATTAAAGACACCTGAGTTATTGGAAAATTTATATAATCTTCCTGCTTCGCCAGAGGTGGTGGTGGCTC

AACTCCAAGGCCAGGTTCTAGAGCTGCAGAGGGAGCTGAAAGAATTCAAAACCCGCAACAAGCAACTCCATGAGAAGCTAATTCTGGCAGAGGCAATGAT

GGAGGGGCTGCCGGTGCCCAACTCTGCGCTGGTGAATG - UNI6710 - TGCCTGCAGCCCAGGCTGTTGTGAGAACAGCCTTCCAGGACAACCCAGG

CGAGCAAGAAGGACCTGAAACCACACAGTCTGCTGGGAGAGACAAGGACATGGACAGTGACCAATATACAAGCTTTGAGATCG ATTCTGAAATCTGTCC

ACCTGATGACCTTGCCTTATTACCAGCATGCAAAGAGAATCTTGAAGACCTCCTAGGCCCATCCTCCATAGCCACTTACCTGGATTCCAAGAGTCAGCTC

TCTGTTAAAGTCAGCGTGAATGGAACTGACCAGTCTGAGAATATCAATATCCCTGATGACACAGAAGACTTAAAACAGAAAATCCACGACTTGCAAACCG

AGCTGGAAGGCTACCGGAACATCATTGTCCAGCTACTGAAGCACTCTCAGTGCAGTGAGGCTATTATCACAGTTTTGTGTGGGACAGAAGGGGCCCAAGA

TGGCTTGAACAAGCCTAAGGGCCATATTGATGAGGAAGAGATGACATTTTCAAGTTTGCACCAAGTACGATATGTGAAGCATATGAAAATCCTCCGTCCA

CTAACCCCGGAGATGATTGATGGCAAGATGCTAGAGAGCCTCAAGCAGCAGCTGGTGGACCAGGAGCAGGAGCTACAGAAGGAGCAGGACTTGAACTTGG

AACTTTTCGGTGAAATCCATGACCTGCAGAACAAGTTCCAAGACCTCTCGCCATCAAG ATACGATTCATTGGTTCAGTCCCAAGCGAGGGAGCTCTCCC

TTCAGCGACAGCAAATTAAGGATAGCCATGGCATCTGTGTCATTTACCGTCAACACATGAGCACCATGATCAAGGCGTTTGAGGAGCTTCTGCAGGCCAG

TGATGTGGACAGTTGCGTGGCCGAGGGCTTCCGGGAGCAGCTGACACAGTGTGCTGGACTGCTAGAGCAACTGGAGAGGCTGTTTCTCCATG GAAAATC

AGCCAGAGTGGAACCACATCCCCAGAATGAACTGCTCAAGGG - UNI9718 - GTTAAGGACTGTGGAAGGCAACTTACCCTACCACCATCTCCTGCC

TGAATCTCCTGAGCCTTCTGCCTCCCATGCTCTGTCAGATGATGAAATGTCTGAGAAGTCCTTCCTGTCTAGAGACCCGAAGCCAGACAGCGATACTGAG

AAGTACCCAGCAATGGCGAGCCATTTTCCTCAAG - UNI9710 - ACTTACTAATGGAACACATACAGGAAATTCGAACTTTGAGAAAGCATTTGGAA

GAATCTATTAAAACAAATGAGAAGCTCCGGAAACAGCTGGAACGGCAGGGGTCTGAGACTGACCAAG GGGCTGACGGGACCACAGGCATACCAG GCTC

CAGAAATGTTTCTGCTTGTGGCTTAGCACTGCACAGCTCTCTGACGTCAGAGATACATTTCCTGAGGAAGCAGAACGAGGCCCTCAGTATGATGCTCGAG

AAGGGGTCCAAAG ATAAACAGAAAGAGAGTGAAAAATTACGTGAGTCCCTGGCTAGGAAAGCTGAGAGTCTTGAGCAACTTCAGCTAGAGTACACCAGT

GTAAGGGAAGAAAATGAAAGGTTACAGAGAGACATCATTGAGAAGGAGAGACACAACCAGGAGCTGACTGAGGAGGTCTGCAGCAGCCGCCAGGAACTGA

GCAG GGTGCAGGAAGAGGCGAAGTCAAGACAGCAGCTGCTCTCACAGAAGGACAAGCTGCTTCAGTCCCTCCAAATGGAGCTCAAGGTGTATGAGAAAC

TGGCCGAGGAACATCCGAGGCTACAGCAAG ATGGCAGCAAATGTCCTGAGGCCAGCGACAATTCATTTGATCTATTTGAATCCACCCAGGCAATGGCAC

CTAAATCAG CTTCTGAGACTCCTCTGCTCTCAGGAACTGATGTTGACTCGCTCTCCTGTGACAGTACCAGTTCTGCCACCAGCCCTACTAGCATGCCCT

GCCTGGTTGCTGGCCACCACATGTGGGCCAGCAAGAGTGGCCACCATATGCTGGGCCTGATTGAGGACTATGATGCCCTCTATAAGCAGATCAGCTGGGG

CCAGACACTGCTTGCCAAGATGGATGTTCAAACCCAAGAGGCTCTGAGCCCCACAAGTCACAAGCTGGGACCAAAG GGTTCTTCATCCGTGCCTCTGAG

CAAGTTTCTTTCCAGTATGAACACAGCCAAGCTGGTCCTGGAAAAAGCATCCAGGTTGCTGAAGCTCTTCTGGAGGGTCTCAGTCCCCACCAACGGCCAG

TGTTCCCTTCACTGTGAGCAG ATTGGAGAAATGAAGGCAGAGAACACGAAACTACACAAAAAATTGTTTGAACAAGAAAAGAAGCTGCAGAACACAGCA

AAACTATTGCAGCAGAGCAAGCACCAGGAGAAAGTCATCTTTGATCAGT TGGTCATCACCCACCAAGTCCTTCGGAAGGCCAGGGGAAACCTGGAG CT

CAGGCCTGGGGCCACCCGTCCAGGAGCATCCAGTCCCAGCAGACCGGGCTCATGAGGAGACCTTTCAGCTAATAAAGCTTGTGGCCCTG
Translation
 - UNI36911 -  - UNI859 - - UNI1571 - - UNI36911 -  - UNI1571 -  - UNI2844 - - UNI31325 -  - UNI2844

 - - UNI31325 -  - UNI31325 -  - UNI20390 -  - UNI20390 -    - UNI8075 -  - UNI7845 -       - UNI885

4 -     - UNI6710 -  MLESLKQQLVDQEQELQKEQDLNLELFGEIHDLQNKFQDLSPSR RYDSLVQSQARELSLQRQQIKDSHGICVIYRQHM

STMIKAFEELLQASDVDSCVAEGFREQLTQCAGLLEQLERLFLHG GKSARVEPHPQNELLKG - UNI9718 - GLRTVEGNLPYHHLLPESPEPSAS

HALSDDEMSEKSFLSRDPKPDSDTEKYPAMASHFPQD - UNI9710 - DLLMEHIQEIRTLRKHLEESIKTNEKLRKQLERQGSETDQG GADGTTGI

PG GSRNVSACGLALHSSLTSEIHFLRKQNEALSMMLEKGSKD DKQKESEKLRESLARKAESLEQLQLEYTSVREENERLQRDIIEKERHNQELTEEVC

SSRQELSR RVQEEAKSRQQLLSQKDKLLQSLQMELKVYEKLAEEHPRLQQD DGSKCPEASDNSFDLFESTQAMAPKSA ASETPLLSGTDVDSLSCDS

TSSATSPTSMPCL    
Transcript ENSMUST00000076541
Sequence
GTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCCGGGGAACCAGTGGCGCTGCCGCCGCCGACACCGGCGCCACCACTCTGCGTTCACG

ATGGACTCGGGGATGGAAGAGGAAGGCGCCCTGCCTGGGACCCTCAGCGGTTGCAG - UNI36911 - TGGCCTTCACCCTGTTCTGCCAAGTGACCT

GGATGTCATCAGTGACACTTCTGGCTTGGGAAATGGAG - UNI859 - - UNI1571 - - UNI36911 - TGCTCCCAAGCATGTCAGAAGAAAA

GGTTTCTCCCACCAGAGCCCGGAACATGAAGGACTTTGAAAAC - UNI1571 - CAAATCACTGAGCTGAAGAAGGAGAACTTCAATCTAAAGCTCCG

GATCTACTTCCTGGAGGAGAGAATCCAGCAGGAGTTTGCTGGCCCCACCGAGCACATCTACAAGACG - UNI2844 - - UNI31325 - AACATTG

AACTCAAGGTGGAAGTGGAAAGTCTGAAGCGCGAGCTCCAGGAGAAAGATCAGTTGCTCGTCAAAGCCTC - UNI2844 - - UNI31325 - CAAA

GCGGTGGAGAGCCTAGCAGAACGGGGTGGTTCTGAAGTCCAGCGGGTGAAAGAAGATGCAAGGAAGAAGGTGCAGCAGGTGGAAGACCTCCTAACGAAAA

GGATACATCTTCTAGAAGAA - UNI31325 - GATGTGAAAGCCGCCCAGGCAGAACTGGAGAAGGCCTTTGCGGGGACAGAAACAGAGAAGGCTCTT

CGGCTCAGCTTAGAAAGCAAGCTCTCGGCGATGAAGAAGATGCAGGAGGGGGACCTGGAGATGACTCTGGCTCTGGAAGAGAAGGACAG - UNI20390

 - ACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTTAAAGAGGAAAAATCTCAGATGGCATCTCCTGACGAGAAC

GTGTCATCTGGAGAACTCCGAGGACTTTCTGCCACTCTGAGGGAAGAAAAAGAGAGAGACGCTGAG - UNI20390 - GAATGGCAGAAGGAGAGAAA

CCACTTTGAAGAGAGGATCCAG GCACTTCAGGAGGACCTGAGAGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAACTTAAAGAGTTATAAAGC

CATTCAGGGTCTAACCATGGCATTAAAATCAAAGGAAAGAGAG GTTGAAGAACTTGATTCCAAAATCAAAGAGGTCACTACGGACTCCACCAAAGGCAG

AGAGGATCCCTTAAAAACCCAGATCCCCAGATTCCAGCTAAGAGAG - UNI8075 - GGGTCTGAGGACTGTGAAGCTGCGCTGGTAGAGAAGGAAGC

CCTATTGGCCAAGCTACACTCAGAAAATGTCACAAAGAGCACTGAGAACCATAGGTTGCTCAGGAATGTTAAAAAGGTCACCCAGGAGTTGAATGACTTG

AAGAAGGAGAAGTTGAGACTAGAGCAGGCCCTGGAGGAAGCCCACCAAGAGGGGAACAGAGGAGCCCGAACCATTCAC - UNI7845 - GACCTTAGA

AATGAAGTTGAGAAACTACGCAAGGAAGTGAGTGAGAGAGAGAAGGCTGTGGAAAAACATTACAAGAGTCTTCCAGGTGAAAGCAAGACAAAGTTTCATA

CTCAAGAACAAGTGGTCAGAAGTCTGACAGGCAGTGGCAGTCAGGAGGACCTGCTGCTTCAG AAATCCAATGAAAAAGATTTGGAAGCAATACAGCAGA

ACTGCTATTTAATGACTGCAGAGGAGCTCAAGTTTGGGAGCGATGGCTTAATAACAGAAAAGTGTTCTCAGCAGTCACCAGACAGCAAACTCATCTTCTC

CAAG GAAAAGCAACAATCAGAGTATGAAGGGCTGACTGGGGACTTAAAAGCAGAACAGAACATCTATGCCCATCTGGCAAAGACTCAGGACACAGACAG

 TGTCAGCAACCTGCAGGCTGAGCTGAAAGAGGTCCTTGCCCTTCGGAAGCAGCTGGAGCAGGATGTTCTTGCCTACCGGAACCTGCAGAAGGCCCTGCA

GGAGCAGCTCAGTGAGATTCGGAGTCGAGAAG AAGAGCCGTTTTCATTTTATAGCGATCAAACATCGTATCTGAGTATTTGCCTTGAAGAGCACAATCA

GTTCCAATTGGAGCATTTTTCTCAAGAAGAACTCAAGAAAAAG GTCAGTGACCTCATACAGCTTGTGAAGGACCTGCACACAGACAACCAGCACCTGAA

GAAAACCATTTTTGATCTCTCTTCTGTGGGTTTCCAGGGAAGTGACAGACTTGAGTTAACAAAACAAGAAGAG - UNI8854 - CTTGTGGCTAGCAA

GGAGGATGAGGACACACTCAAATTTGAAGCGGACGTTGAGACTCCTTTCCAGAGTGACCAGCATTTGGAGCAAAGTCGTGAG ATCATGGAGGACTATGC

TGAGGGTGGCTGCAAAAGTGGATATGGAAGGCACATGGATTCCAATATTTTAGGTCATGATGGGGCCCAAACTCCTGGTGCCTCTGAAGAGCACACCCTA

GAAGATGAGCTCCTGGGCCTGCTTGCCACTCTCTTCAGTAAGAAGGCCACACCGTTGCTGGAATCCAG GCCAGATCTTCTGAAAGCACTCGGTGCCCTA

CTTTTGGAACGCATATGCTTGGCAGAGCAGGGTCGTCCTGGAGATCACCTTGATAGTAAAACTGAGAAGGCACTTCAGCAAGTAGCTGTTCAGTTGAGAG

ATGAACTTGGCCATTCCTTCCCTGCCAACTCGTTCTCCAAGTCATACAATGAAGTCAAGTCAATGTGGGGAAATTGGCTGGTAAAGACAGGAGACGAAGA

CACGGTGGAGCTGAAGAGTGTTTCAGTGCAGACCATGGCCATAGAGGACACCCCGCATGGATTCAAACCTCAAAGCAAGAGAGATGCTTGGGCAGAGAAA

CAAGAAGAGGCCATTTTCAGCACTGAGCTTGAGTCAGAGGCGTTGGGTGAGATGCCAGGGCAACAGGCCACTCACCTCTCATTCCCCAGTGCCATCAACC

CG GATGCCGAGAAGACGGGCTTGTTGATCCAATTAAAGACACCTGAGTTATTGGAAAATTTATATAATCTTCCTGCTTCGCCAGAGGTGGTGGTGGCTC

AACTCCAAGGCCAGGTTCTAGAGCTGCAGAGGGAGCTGAAAGAATTCAAAACCCGCAACAAGCAACTCCATGAGAAGCTAATTCTGGCAGAGGCAATGAT

GGAGGGGCTGCCGGTGCCCAACTCTGCGCTGGTGAATG - UNI6710 - TGCCTGCAGCCCAGGCTGTTGTGAGAACAGCCTTCCAGGACAACCCAGG

CGAGCAAGAAGGACCTGAAACCACACAGTCTGCTGGGAGAGACAAGGACATGGACAGTGACCAATATACAAGCTTTGAGATCG ATTCTGAAATCTGTCC

ACCTGATGACCTTGCCTTATTACCAGCATGCAAAGAGAATCTTGAAGACCTCCTAGGCCCATCCTCCATAGCCACTTACCTGGATTCCAAGAGTCAGCTC

TCTGTTAAAGTCAGCGTGAATGGAACTGACCAGTCTGAGAATATCAATATCCCTGATGACACAGAAGACTTAAAACAGAAAATCCACGACTTGCAAACCG

AGCTGGAAGGCTACCGGAACATCATTGTCCAGCTACTGAAGCACTCTCAGTGCAGTGAGGCTATTATCACAGTTTTGTGTGGGACAGAAGGGGCCCAAGA

TGGCTTGAACAAGCCTAAGGGCCATATTGATGAGGAAGAGATGACATTTTCAAGTTTGCACCAAGTACGATATGTGAAGCATATGAAAATCCTCCGTCCA

CTAACCCCGGAGATGATTGATGGCAAGATGCTAGAGAGCCTCAAGCAGCAGCTGGTGGACCAGGAGCAGGAGCTACAGAAGGAGCAGGACTTGAACTTGG

AACTTTTCGGTGAAATCCATGACCTGCAGAACAAGTTCCAAGACCTCTCGCCATCAAG ATACGATTCATTGGTTCAGTCCCAAGCGAGGGAGCTCTCCC

TTCAGCGACAGCAAATTAAGGATAGCCATGGCATCTGTGTCATTTACCGTCAACACATGAGCACCATGATCAAGGCGTTTGAGGAGCTTCTGCAGGCCAG

TGATGTGGACAGTTGCGTGGCCGAGGGCTTCCGGGAGCAGCTGACACAGTGTGCTGGACTGCTAGAGCAACTGGAGAGGCTGTTTCTCCATG GAAAATC

AGCCAGAGTGGAACCACATCCCCAGAATGAACTGCTCAAGGG - UNI9718 - GTTAAGGACTGTGGAAGGCAACTTACCCTACCACCATCTCCTGCC

TGAATCTCCTGAGCCTTCTGCCTCCCATGCTCTGTCAGATGATGAAATGTCTGAGAAGTCCTTCCTGTCTAGAGACCCGAAGCCAGACAGCGATACTGAG

AAGTACCCAGCAATGGCGAGCCATTTTCCTCAAG - UNI9710 - ACTTACTAATGGAACACATACAGGAAATTCGAACTTTGAGAAAGCATTTGGAA

GAATCTATTAAAACAAATGAGAAGCTCCGGAAACAGCTGGAACGGCAGGGGTCTGAGACTGACCAAG GCTCCAGAAATGTTTCTGCTTGTGGCTTAGCA

CTGCACAGCTCTCTGACGTCAGAGATACATTTCCTGAGGAAGCAGAACGAGGCCCTCAGTATGATGCTCGAGAAGGGGTCCAAAG ATAAACAGAAAGAG

AGTGAAAAATTACGTGAGTCCCTGGCTAGGAAAGCTGAGAGTCTTGAGCAACTTCAGCTAGAGTACACCAGTGTAAGGGAAGAAAATGAAAGGTTACAGA

GAGACATCATTGAGAAGGAGAGACACAACCAGGAGCTGACTGAGGAGGTCTGCAGCAGCCGCCAGGAACTGAGCAG GGTGCAGGAAGAGGCGAAGTCAA

GACAGCAGCTGCTCTCACAGAAGGACAAGCTGCTTCAGTCCCTCCAAATGGAGCTCAAGGTGTATGAGAAACTGGCCGAGGAACATCCGAGGCTACAGCA

AG ATGGCAGCAAATGTCCTGAGGCCAGCGACAATTCATTTGATCTATTTGAATCCACCCAGGCAATGGCACCTAAATCAG CTTCTGAGACTCCTCTGC

TCTCAGGAACTGATGTTGACTCGCTCTCCTGTGACAGTACCAGTTCTGCCACCAGCCCTACTAGCATGCCCTGCCTGGTTGCTGGCCACCACATGTGGGC

CAGCAAGAGTGGCCACCATATGCTGGGCCTGATTGAGGACTATGATGCCCTCTATAAGCAGATCAGCTGGGGCCAGACACTGCTTGCCAAGATGGATGTT

CAAACCCAAGAGGCTCTGAGCCCCACAAGTCACAAGCTGGGACCAAAG GGTTCTTCATCCGTGCCTCTGAGCAAGTTTCTTTCCAGTATGAACACAGCC

AAGCTGGTCCTGGAAAAAGCATCCAGGTTGCTGAAGCTCTTCTGGAGGGTCTCAGTCCCCACCAACGGCCAGTGTTCCCTTCACTGTGAGCAG ATTGGA

GAAATGAAGGCAGAGAACACGAAACTACACAAAAAATTGTTTGAACAAGAAAAGAAGCTGCAGAACACAGCAAAACTATTGCAGCAGAGCAAGCACCAGG

AGAAAGTCATCTTTGATCAGT TGGTCATCACCCACCAAGTCCTTCGGAAGGCCAGGGGAAACCTGGAG CTCAGGCCTGGGGCCACCCGTCCAGGAGCA

TCCAGTCCCAGCAGACCGGGCTCATGAGGAGACCTTTCAGCTAATAAAGCTTGTGGCCCTG
Translation
MDSGMEEEGALPGTLSGCS - UNI36911 - SGLHPVLPSDLDVISDTSGLGNGV - UNI859 - - UNI1571 - - UNI36911 - VLPSMS

EEKVSPTRARNMKDFEN - UNI1571 - QITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKT - UNI2844 - - UNI31325 - NIELKVE

VESLKRELQEKDQLLVKAS - UNI2844 - - UNI31325 - SKAVESLAERGGSEVQRVKEDARKKVQQVEDLLTKRIHLLEE - UNI31325 -

 DVKAAQAELEKAFAGTETEKALRLSLESKLSAMKKMQEGDLEMTLALEEKDR - UNI20390 - RLIEELKLSLKSKEALIQCLKEEKSQMASPDEN

VSSGELRGLSATLREEKERDAE - UNI20390 - EWQKERNHFEERIQ ALQEDLREKEREIATEKKNNLKSYKAIQGLTMALKSKERE VEELDSKI

KEVTTDSTKGREDPLKTQIPRFQLRE - UNI8075 - GSEDCEAALVEKEALLAKLHSENVTKSTENHRLLRNVKKVTQELNDLKKEKLRLEQALEEA

HQEGNRGARTIH - UNI7845 - DLRNEVEKLRKEVSEREKAVEKHYKSLPGESKTKFHTQEQVVRSLTGSGSQEDLLLQ KSNEKDLEAIQQNCYLM

TAEELKFGSDGLITEKCSQQSPDSKLIFSK EKQQSEYEGLTGDLKAEQNIYAHLAKTQDTDS SVSNLQAELKEVLALRKQLEQDVLAYRNLQKALQEQ

LSEIRSREE EEPFSFYSDQTSYLSICLEEHNQFQLEHFSQEELKKK VSDLIQLVKDLHTDNQHLKKTIFDLSSVGFQGSDRLELTKQEE - UNI885

4 - LVASKEDEDTLKFEADVETPFQSDQHLEQSRE IMEDYAEGGCKSGYGRHMDSNILGHDGAQTPGASEEHTLEDELLGLLATLFSKKATPLLESR 

RPDLLKALGALLLERICLAEQGRPGDHLDSKTEKALQQVAVQLRDELGHSFPANSFSKSYNEVKSMWGNWLVKTGDEDTVELKSVSVQTMAIEDTPHGFK

PQSKRDAWAEKQEEAIFSTELESEALGEMPGQQATHLSFPSAINP DAEKTGLLIQLKTPELLENLYNLPASPEVVVAQLQGQVLELQRELKEFKTRNKQ

LHEKLILAEAMMEGLPVPNSALVNV - UNI6710 - VPAAQAVVRTAFQDNPGEQEGPETTQSAGRDKDMDSDQYTSFEID DSEICPPDDLALLPAC

KENLEDLLGPSSIATYLDSKSQLSVKVSVNGTDQSENINIPDDTEDLKQKIHDLQTELEGYRNIIVQLLKHSQCSEAIITVLCGTEGAQDGLNKPKGHID

EEEMTFSSLHQVRYVKHMKILRPLTPEMIDGKMLESLKQQLVDQEQELQKEQDLNLELFGEIHDLQNKFQDLSPSR RYDSLVQSQARELSLQRQQIKDS

HGICVIYRQHMSTMIKAFEELLQASDVDSCVAEGFREQLTQCAGLLEQLERLFLHG GKSARVEPHPQNELLKG - UNI9718 - GLRTVEGNLPYHH

LLPESPEPSASHALSDDEMSEKSFLSRDPKPDSDTEKYPAMASHFPQD - UNI9710 - DLLMEHIQEIRTLRKHLEESIKTNEKLRKQLERQGSETD

QG GSRNVSACGLALHSSLTSEIHFLRKQNEALSMMLEKGSKD DKQKESEKLRESLARKAESLEQLQLEYTSVREENERLQRDIIEKERHNQELTEEVC

SSRQELSR RVQEEAKSRQQLLSQKDKLLQSLQMELKVYEKLAEEHPRLQQD DGSKCPEASDNSFDLFESTQAMAPKSA ASETPLLSGTDVDSLSCDS

TSSATSPTSMPCLVAGHHMWASKSGHHMLGLIEDYDALYKQISWGQTLLAKMDVQTQEALSPTSHKLGPK GSSSVPLSKFLSSMNTAKLVLEKASRLLK

LFWRVSVPTNGQCSLHCEQ IGEMKAENTKLHKKLFEQEKKLQNTAKLLQQSKHQEKVIFDQL LVITHQVLRKARGNLE LRPGATRPGASSPSRPGS

For any suggestions or comments, please send an email to unitrap@crg.es