Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039316 (Rftn1)
Chromosomal location
Chr 17: 50132585 - 50329822 (-)
Description
raftlin lipid raft linker 1 Gene [Source:MGI (curated);Acc:Rftn1-001]
RefSeq_dna
NM_181397 
RefSeq_peptide
NP_852062.1 
UniGene
Mm.41854 
MGI
MGI:1923688 
Uniprot/SWISSPROT
Q6A0D4 
Uniprot/SPTREMBL
Q80VF9 Q8C4D5 
Human Ortholog
not available
Omim not available
UniTrap UNI36514
Vector Insertion
Chr 17: 50246394 - 50308485
Public Clones IST13431C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34590
Vector Insertion
Chr 17: 50194561 - 50226002
Public Clones IST13986G9 (tigm) IST12781E5 (tigm) IST14043H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113195
Sequence
AGGATGTGGCAAGATTTTCTCTAAAGTCGCGGTGTAGTATGTTGATGCTAAGCTGTAACAGACACTCACTTGGCAGCACACAGCTCCTTGAGAGTGTGTG

GCGACAGTGTCATCATATCCAGAATGTTCCTATAGATACCCAACCTTTATGACAGAA - UNI34590 - GTCTCAGAAGGCTGAGCTTCACGACGAAG

GCTACACCCTGGAATTGGATTACTGCTCCTCCTTAGAACACCTGGCCGACCAGAAGCTCATCCCAGAGTTCATTAAGAAG - UNI34590 - GTGCAG

GAGGCCGCCAGTCAGGGCTTGAAGTTTGTTAGCGTGGTGCCCCAGTACCAGCCCTCGGTGAGCTCAGCAGGCAGCCGGCGTCTCAAGCCTGTTGCCAACA

GTGTTGAAGATGCCAGGGATGTGAAATGCACCTTAGGGGACCGTTCATCCTTGGAAAATGATACTCCGAAGGCTGCAGAGACGGATGCTGCCACTGCAGG

AGTGAACCGAAGACCGGAGACCAAACCAGGATCCACAGGGGACGTGCCCAGTGCCCAGCAGCCTGGCATTCCCTCTCCCTCGGCAGAGAATGAGGCTGGC

GAGTTTCCACTGCGGGGTTTGCAGCCAGCACTGGATAGATCAGAGGGCGACCCCTCAAATGGGCCTGAAGAGCTGCCCTCCAGGA - UNI34590 - A

GATGGAGATCTTCGCCTTTTTCAACAGACCGAAGAGCCAGCAGAAATGTCGGCAGTACTACCCTGTCACCATCCCCCTCCAGGTCTCCAAGAACGGCCAG

ACAGTGAGCAGTCTAGACGCCAGCTGGCTGGAACACATGAGTGACCATTTCCGGAAAGGCGGTGTGCTGGTGAACGCCGTCTTCCAGCTTGGCATGGCCA

ATG ATTCCTTCTATGGCCTGACAGATGGAGTATTCATCTTTGAAGCTGTTTCCACAGAAGATAACAGAACCACACAGGGCTATGACGCTATTGTTGTGG

AACAATGGACAGTCCTAGAA GGTACAGAGGTACAGACCGACTACATGCCCCTGCTGAACTCGCTGGCGGCCTACGGATGGCAGCTCACCTGTGTGCTGC

CAACGCCTATACTCAAGACTACCAG GGAAGGGAACGTGTCCACCAAGCAGATTGTGTTTCTTCAGAGACCATGTCTACCTCAGAAAACCAAGAAGAGGG

AATCTAAG TTCCAGTGGCGATTCTCCCGGAACGAGATCCACGGCAGGCAGACAAGGAAATCCAAAGGGAAACTCAGTGCCAGCAACAAGCAGCAAGCAG

AAGAGAATGAGAAGAATCTGGAAGACCAGTTCTCCAAGGCTGGAGATGTGGGAAACTGTGTGCTGGGGGCACCGCAGTGGGGCAGAGCCTCTGAGGTCAG

GGAGCAAAGGCAGGGCTCAGCAGCTGTGCAGAATGGTCCCGCTGGCCACAACAGGGACTCGGTGGCCCTTAGGCACTCGAATCCCAGAGCTGAGGCTGAG

CTTGCTGCAGGCCCCACTCCAACAGAAGCAAATTGAGTCCGTGGTTTATGCTAGGCCTGCATTGTGATTGCAAACCTTGGGAAGCTTGCTAGCAGCTGGT

TTGTTCTGTGTTACCCTTTGGCTTGACCTCCCATTGTTAGCTCATTGGCCCCGTGAGCGCGGGTCTCTGATGGTGTTGTTTTCTGCACATCCACTGGAAA

GCTGTCTTAATGATCCACTTCTTTTAGAGTGCAAAGTTGGCCTGTTCCTCCCAGACCTCAGGGCTGGAGGCCCGACTCTGGTCCGCCTCTTCCACAAGGA

AGGGCATGGACCATAGTGCCTGTACTGCCCCACAGGACTCCAGGGCACATCTGGGTCAACTTCTGGGACATCCTTTGCTACAAACCAAGGTTTTTCTGCT

CACTCCTACATGCTGCTGCTCTGGGCAAGAACATAGTGACATTAACCCTGCAGCCTGCCGGCTGGCCTTCCCCACCTGAGCTCTGGAGACCCTGCTGTTG

TGGAAGGCAAGGATGTTGGAGAATAGGAGGTACCCAAGCCTCCTGCCTGTCTTAAGGTAGTTCTATAGATACTGGTGATCTGGAAACAAACAGGTAATTC

CCTAAGCCCCGGCTCTTACAGAATGTTCAAGAAAGTATCCTGTGTTAATATTAATGCCAAAAAAATACTGTTTTTAAATTTTGTCTTCAACACATGTATG

AATATGTTGTCATTTTGAGCAGTTGGTAACTGGGTGCCCTTGTGTGCTGTTTTTGTTGATGTGTCATTGAGTTGTATGCTGTGCCTGTCACATGTTCATA

CTGTCCATAACGTGTTGTTAAGGCTTTAAGTAGAAGCATCTGGCAAACCATGGAGCGAGAACACCAGTTGTCTCGATGGAAACAGCCCTGTCTCTTTCTT

GTTTATTTAAAGCAATAAATGACCTGAGTTG
Translation
 - UNI34590 -  - UNI34590 -  - UNI34590 - MEIFAFFNRPKSQQKCRQYYPVTIPLQVSKNGQTVSSLDASWLEHMSDHFRKGGVLVN

AVFQLGMAND DSFYGLTDGVFIFEAVSTEDNRTTQGYDAIVVEQWTVLE GTEVQTDYMPLLNSLAAYGWQLTCVLPTPILKTTR REGNVSTKQIVFL

QRPCLPQKTKKRESK FQWRFSRNEIHGRQTRKSKGKLSASNKQQAEENEKNLEDQFSKAGDVGNCVLGAPQWGRASEVREQRQGSAAVQNGPAGHNRDS

VALRHSNPRAEAELAAGPTPTEAN
Transcript ENSMUST00000044503
Sequence
CGCGGGGTGGAGTGGGGGCGGCGGGGCTGGAATCAGAGCGCGCAGGGCGCAGAGCGCAGCGAGCGGGAGCGCGGCGGCCACTGGCTCTGGAGAGGTACCT

GTGCGGCCAGCGCCGGAGGGACAGACGACAAGCGAGCGGCCGCGCCCCGCGCTCTGCCCCCACCCCCGGGGTCGCGTCGTCCGCGCGCCGCCCTGCTCTG

CATGGCACAAACTTTCATCCCGGGACACAGCACGCTGTCTCCGCCCGCGCCACGGTCACCGCTGCTGGTCCCCTAAG - UNI36514 - ACAGCTGTC

AAGATGGGTTGCAGTTTGAACAAGCTGGAGAAACGTGAAGAAAAGCGGCCTGGGAACATTTATTCAACTCTGAAGAGACCTCAGGTGGAGACCAAAGTAG

ATGTGACCTATGAGTACTGCTTTCTAGAGTTCACCACACTGACTGCCG - UNI36514 - CGGAGCTGCCGAGATCCTCCGCCACGAGGTTAGCCTCT

CTGCGGGACCTGCCTGACCAGCTTCTGGAGCTGTACCAACAAGGCTTCTCACTGGCCGCCCTGCACCCATTTGTGCAGCCAACCCGCAGGCAAGAGAAGA

TCCTCCTGGAACACATCTTTCGGGCCATCCTGGTCAAGAAAACCAACAG - UNI34590 - - UNI36514 - GTCTCAGAAGGCTGAGCTTCACGA

CGAAGGCTACACCCTGGAATTGGATTACTGCTCCTCCTTAGAACACCTGGCCGACCAGAAGCTCATCCCAGAGTTCATTAAGAAG - UNI34590 - G

TGCAGGAGGCCGCCAGTCAGGGCTTGAAGTTTGTTAGCGTGGTGCCCCAGTACCAGCCCTCGGTGAGCTCAGCAGGCAGCCGGCGTCTCAAGCCTGTTGC

CAACAGTGTTGAAGATGCCAGGGATGTGAAATGCACCTTAGGGGACCGTTCATCCTTGGAAAATGATACTCCGAAGGCTGCAGAGACGGATGCTGCCACT

GCAGGAGTGAACCGAAGACCGGAGACCAAACCAGGATCCACAGGGGACGTGCCCAGTGCCCAGCAGCCTGGCATTCCCTCTCCCTCGGCAGAGAATGAGG

CTGGCGAGTTTCCACTGCGGGGTTTGCAGCCAGCACTGGATAGATCAGAGGGCGACCCCTCAAATGGGCCTGAAGAGCTGCCCTCCAGGA - UNI3459

0 - AGATGGAGATCTTCGCCTTTTTCAACAGACCGAAGAGCCAGCAGAAATGTCGGCAGTACTACCCTGTCACCATCCCCCTCCAGGTCTCCAAGAACG

GCCAGACAGTGAGCAGTCTAGACGCCAGCTGGCTGGAACACATGAGTGACCATTTCCGGAAAGGCGGTGTGCTGGTGAACGCCGTCTTCCAGCTTGGCAT

GGCCAATG ATTCCTTCTATGGCCTGACAGATGGAGTATTCATCTTTGAAGCTGTTTCCACAGAAGATAACAGAACCACACAGGGCTATGACGCTATTGT

TGTGGAACAATGGACAGTCCTAGAA GGTACAGAGGTACAGACCGACTACATGCCCCTGCTGAACTCGCTGGCGGCCTACGGATGGCAGCTCACCTGTGT

GCTGCCAACGCCTATACTCAAGACTACCAG GGAAGGGAACGTGTCCACCAAGCAGATTGTGTTTCTTCAGAGACCATGTCTACCTCAGAAAACCAAGAA

GAGGGAATCTAAG TTCCAGTGGCGATTCTCCCGGAACGAGATCCACGGCAGGCAGACAAGGAAATCCAAAGGGAAACTCAGTGCCAGCAACAAGCAGCA

AGCAGAAGAGAATGAGAAGAATCTGGAAGACCAGTTCTCCAAGGCTGGAGATGTGGGAAACTGTGTGCTGGGGGCACCGCAGTGGGGCAGAGCCTCTGAG

GTCAGGGAGCAAAGGCAGGGCTCAGCAGCTGTGCAGAATGGTCCCGCTGGCCACAACAGGGACTCGGTGGCCCTTAGGCACTCGAATCCCAGAGCTGAGG

CTGAGCTTGCTGCAGGCCCCACTCCAACAGAAGCAAATTGAGTCCGTGGTTTATGCTAGGCCTGCATTGTGATTGCAAACCTTGGGAAGCTTGCTAGCAG

CTGGTTTGTTCTGTGTTACCCTTTGGCTTGACCTCCCATTGTTAGCTCATTGGCCCCGTGAGCGCGGGTCTCTGATGGTGTTGTTTTCTGCACATCCACT

GGAAAGCTGTCTTAATGATCCACTTCTTTTAGAGTGCAAAGTTGGCCTGTTCCTCCCAGACCTCAGGGCTGGAGGCCCGACTCTGGTCCGCCTCTTCCAC

AAGGAAGGGCATGGACCATAGTGCCTGTACTGCCCCACAGGACTCCAGGGCACATCTGGGTCAACTTCTGGGACATCCTTTGCTACAAACCAAGGTTTTT

CTGCTCACTCCTACATGCTGCTGCTCTGGGCAAGAACATAGTGACATTAACCCTGCAGCCTGCCGGCTGGCCTTCCCCACCTGAGCTCTGGAGACCCTGC

TGTTGTGGAAGGCAAGGATGTTGGAGAATAGGAGGTACCCAAGCCTCCTGCCTGTCTTAAGGTAGTTCTATAGATACTGGTGATCTGGAAACAAACAGGT

AATTCCCTAAGCCCCGGCTCTTACAGAATGTTCAAGAAAGTATCCTGTGTTAATATTAATGCCAAAAAAATACTGTTTTTAAATTTTGTCTTCAACACAT

GTATGAATATGTTGTCATTTTGAGCAGTTGGTAACTGGGTGCCCTTGTGTGCTGTTTTTGTTGATGTGTCATTGAGTTGTATGCTGTGCCTGTCACATGT

TCATACTGTCCATAACGTGTTGTTAAGGCTTTAAGTAGAAGCATCTGGCAAACCATGGAGCGAGAACACCAGTTGTCTCGATGGAAACA
Translation
 - UNI36514 - MGCSLNKLEKREEKRPGNIYSTLKRPQVETKVDVTYEYCFLEFTTLTAA - UNI36514 - AELPRSSATRLASLRDLPDQLLE

LYQQGFSLAALHPFVQPTRRQEKILLEHIFRAILVKKTNR - UNI34590 - - UNI36514 - RSQKAELHDEGYTLELDYCSSLEHLADQKLIPE

FIKK - UNI34590 - VQEAASQGLKFVSVVPQYQPSVSSAGSRRLKPVANSVEDARDVKCTLGDRSSLENDTPKAAETDAATAGVNRRPETKPGSTG

DVPSAQQPGIPSPSAENEAGEFPLRGLQPALDRSEGDPSNGPEELPSRK - UNI34590 - KMEIFAFFNRPKSQQKCRQYYPVTIPLQVSKNGQTVS

SLDASWLEHMSDHFRKGGVLVNAVFQLGMAND DSFYGLTDGVFIFEAVSTEDNRTTQGYDAIVVEQWTVLE GTEVQTDYMPLLNSLAAYGWQLTCVLP

TPILKTTR REGNVSTKQIVFLQRPCLPQKTKKRESK FQWRFSRNEIHGRQTRKSKGKLSASNKQQAEENEKNLEDQFSKAGDVGNCVLGAPQWGRASE

VREQRQGSAAVQNGPAGHNRDSVALRHSNPRAEAELAAGPTPTEAN

For any suggestions or comments, please send an email to unitrap@crg.es